BLASTX nr result
ID: Stemona21_contig00018548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00018548 (663 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146829.1| PREDICTED: viral IAP-associated factor homol... 57 4e-06 ref|XP_002509555.1| Phosducin, putative [Ricinus communis] gi|22... 57 5e-06 ref|XP_004249174.1| PREDICTED: viral IAP-associated factor homol... 57 6e-06 >ref|XP_004146829.1| PREDICTED: viral IAP-associated factor homolog [Cucumis sativus] gi|449476675|ref|XP_004154803.1| PREDICTED: viral IAP-associated factor homolog [Cucumis sativus] Length = 254 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +3 Query: 3 DCEILLKCLRELAMRYLLTKFVMIVSTDCIPNYQDLDM 116 +C++L+ CL+ELA RY TKFV I+STDCIPNY D ++ Sbjct: 134 ECDVLMNCLQELAARYPATKFVKIISTDCIPNYPDCNL 171 >ref|XP_002509555.1| Phosducin, putative [Ricinus communis] gi|223549454|gb|EEF50942.1| Phosducin, putative [Ricinus communis] Length = 251 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +3 Query: 3 DCEILLKCLRELAMRYLLTKFVMIVSTDCIPNYQDLDM 116 +C +LL+CL ELA RY TKFV I+STDCIPNY D ++ Sbjct: 132 ECGVLLRCLEELATRYPATKFVKIISTDCIPNYPDYNL 169 >ref|XP_004249174.1| PREDICTED: viral IAP-associated factor homolog [Solanum lycopersicum] gi|565393093|ref|XP_006362218.1| PREDICTED: phosducin-like protein 3-like [Solanum tuberosum] Length = 251 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +3 Query: 6 CEILLKCLRELAMRYLLTKFVMIVSTDCIPNYQDLDM 116 C+ILL+CL ELA +Y +TKFV I+STDCIPNY D ++ Sbjct: 135 CQILLQCLDELATKYPVTKFVKIISTDCIPNYPDCNL 171