BLASTX nr result
ID: Stemona21_contig00016090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00016090 (345 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004238956.1| PREDICTED: uncharacterized protein LOC101263... 56 4e-06 >ref|XP_004238956.1| PREDICTED: uncharacterized protein LOC101263023 [Solanum lycopersicum] Length = 400 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -3 Query: 340 KYRLHSRQSPPPMEINNNSSSHPPQFVVVSGIWVLPTEYSA 218 KYRLH+R+ P P I+NN++ PPQFVVV GIWV P EY++ Sbjct: 271 KYRLHTRR-PSPSSIHNNNNQQPPQFVVVGGIWVPPPEYAS 310