BLASTX nr result
ID: Stemona21_contig00015356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00015356 (536 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528664.1| ccaat-binding transcription factor subunit A... 72 8e-11 >ref|XP_002528664.1| ccaat-binding transcription factor subunit A, putative [Ricinus communis] gi|223531887|gb|EEF33703.1| ccaat-binding transcription factor subunit A, putative [Ricinus communis] Length = 220 Score = 72.0 bits (175), Expect = 8e-11 Identities = 44/119 (36%), Positives = 53/119 (44%), Gaps = 2/119 (1%) Frame = -3 Query: 534 PLKVYLNKYRDTEGEKNSMARQGDQSPPQEPSIGLNNXXXXXXXXXXXXXXXXXXXXXXX 355 PLKVYLNKYR+TEGEKNSMAR +QSPP I N Sbjct: 102 PLKVYLNKYRETEGEKNSMARHDEQSPPPTTEINKLNDSSLPTDHHHVEVQGFNCTTGFY 161 Query: 354 XXXXXXXXXXXXXXXGRMMAYGEKSKS-SGSFSMGTVNGGGEANGARALPSHL-HGVHW 184 R + YGE S +G F+ + G G+ NG RA+ + L HGV W Sbjct: 162 SLGSQVTNKSYGDNYTRSVGYGENLVSGAGGFNFNKIRGNGDGNGNRAVAAQLHHGVEW 220