BLASTX nr result
ID: Stemona21_contig00014495
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00014495 (295 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD56221.1| hypothetical protein [Cicer arietinum] 59 5e-07 >emb|CAD56221.1| hypothetical protein [Cicer arietinum] Length = 206 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = +3 Query: 174 MIREHQLSRVLRISCTIYYLVASTACFLQMIKIQVIAERE 293 +I HQL ++LRISC+ YYLVAS+ACF+ ++KIQV+AERE Sbjct: 8 VISNHQLWKILRISCSFYYLVASSACFVHIMKIQVLAERE 47