BLASTX nr result
ID: Stemona21_contig00014221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00014221 (261 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006374744.1| hypothetical protein POPTR_0014s00420g [Popu... 57 3e-06 ref|XP_006383287.1| hypothetical protein POPTR_0005s13880g [Popu... 56 4e-06 >ref|XP_006374744.1| hypothetical protein POPTR_0014s00420g [Populus trichocarpa] gi|550323003|gb|ERP52541.1| hypothetical protein POPTR_0014s00420g [Populus trichocarpa] Length = 260 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/71 (42%), Positives = 50/71 (70%), Gaps = 2/71 (2%) Frame = -1 Query: 213 DNSDHLASQIGELAGAIRSIHRGIS--SELLSEVMKSEGYDEVSLGKAFDYLHVNENLGR 40 D + L+ QIG++ AI+S+ + + L +EVMK EG+DE++LG+AFD+L N+ L + Sbjct: 174 DGVEKLSKQIGDVELAIQSLSKNQLDVNALYAEVMKIEGFDEITLGEAFDHLVQNKMLAK 233 Query: 39 AFLVKSSILRQ 7 AF+ K++ LR+ Sbjct: 234 AFMAKNANLRK 244 >ref|XP_006383287.1| hypothetical protein POPTR_0005s13880g [Populus trichocarpa] gi|550338877|gb|ERP61084.1| hypothetical protein POPTR_0005s13880g [Populus trichocarpa] Length = 266 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/73 (39%), Positives = 50/73 (68%), Gaps = 2/73 (2%) Frame = -1 Query: 213 DNSDHLASQIGELAGAIRSIHRGISS--ELLSEVMKSEGYDEVSLGKAFDYLHVNENLGR 40 D+ + L+++IG++A I+S+ + + EL EVMK +G++E++LG AFD+L N+ L + Sbjct: 188 DSVEKLSTKIGDVAFVIQSLRKNQLNVNELYIEVMKIKGFEEIALGDAFDHLVQNKMLAK 247 Query: 39 AFLVKSSILRQAW 1 AF+ K LR+ W Sbjct: 248 AFMKKYDNLRKIW 260