BLASTX nr result
ID: Stemona21_contig00014059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00014059 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003563134.1| PREDICTED: thioredoxin-like protein CDSP32, ... 55 7e-06 >ref|XP_003563134.1| PREDICTED: thioredoxin-like protein CDSP32, chloroplastic-like [Brachypodium distachyon] Length = 310 Score = 55.5 bits (132), Expect = 7e-06 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 10/70 (14%) Frame = +3 Query: 99 RRIPNLTRSRRQA----------KLFPRSSASSGAATKPGKVGDERVQRVHSTEEFDAAL 248 R +P+ +R RR A K P S+S G K G+ DERV +VHS EEFDAAL Sbjct: 38 RFLPSTSRRRRAALRAAAVSGTEKANPAPSSSPGNNNKGGR--DERVVQVHSAEEFDAAL 95 Query: 249 RAAKNRLVVV 278 +AAKNRLVVV Sbjct: 96 QAAKNRLVVV 105