BLASTX nr result
ID: Stemona21_contig00011486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00011486 (3107 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617240.1| Auxin-induced protein 5NG4 [Medicago truncat... 60 8e-06 >ref|XP_003617240.1| Auxin-induced protein 5NG4 [Medicago truncatula] gi|355518575|gb|AET00199.1| Auxin-induced protein 5NG4 [Medicago truncatula] Length = 351 Score = 59.7 bits (143), Expect = 8e-06 Identities = 34/60 (56%), Positives = 41/60 (68%) Frame = -2 Query: 1477 FVMRSIIAPLSMVFVQLSVAGRLILSRIILNRGTFVFSFLTYRSIVGAFSVAPLGGIFER 1298 FV+ SI+ SM+FVQL V G ILSRIIL GTF+F+ +YR +V A VAPL FER Sbjct: 10 FVLSSIL--WSMIFVQLIVTGTQILSRIILVEGTFIFALTSYRVLVAAVCVAPLAIYFER 67