BLASTX nr result
ID: Stemona21_contig00007111
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00007111 (299 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB09084.1| early flowering protein 1 [Asparagus officinalis] 51 5e-07 >gb|AAB09084.1| early flowering protein 1 [Asparagus officinalis] Length = 159 Score = 51.2 bits (121), Expect(2) = 5e-07 Identities = 24/53 (45%), Positives = 33/53 (62%) Frame = -3 Query: 159 TLIAGGDLGTKVSSTIDRLKLEPSADGRCVFKLAGGYTIIPGVDAAEYIKVDK 1 +LI GGDLGTK+ S KL PS++G CV KL G + +PGV+ + + K Sbjct: 85 SLIEGGDLGTKLESASSHFKLVPSSNGGCVVKLEGIFKALPGVETTDEVAKGK 137 Score = 28.1 bits (61), Expect(2) = 5e-07 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -2 Query: 226 ALPYSYSEERVDVLDKENFE 167 A+P+ Y +ER+D +D+ NFE Sbjct: 62 AMPFPYLKERLDFVDEANFE 81