BLASTX nr result
ID: Stemona21_contig00005809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00005809 (1124 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004303901.1| PREDICTED: transcription factor PIF5-like [F... 45 1e-06 ref|XP_002306764.2| hypothetical protein POPTR_0005s22870g [Popu... 41 2e-06 >ref|XP_004303901.1| PREDICTED: transcription factor PIF5-like [Fragaria vesca subsp. vesca] Length = 540 Score = 44.7 bits (104), Expect(2) = 1e-06 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 2/90 (2%) Frame = -1 Query: 758 SQSRLVHRQEMPLKCGVTLGNSGNRIQEADSLGWFGYPIGNSLKKELFSDFFCEILAAD- 582 ++SR V + + ++ G GNSGN I + +++ YP+ +S K+ S FF E+ + D Sbjct: 54 NESRQVQKHDQ-MRVGGFYGNSGNLIHDEEAVSMIQYPLEDSFDKDFCSHFFSELPSCDP 112 Query: 581 -SKDKLIKDVTPEVRFVKFCAAEESFLAKT 495 +K IK E +FVKF A+ + L + Sbjct: 113 LEIEKPIKQFGEE-KFVKFDASNATHLVSS 141 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 14/25 (56%), Positives = 21/25 (84%) Frame = -2 Query: 844 PYNKVVELLWQDGHVVIHSQNYQKP 770 P +++VELLW++G VV+HSQ +KP Sbjct: 25 PDHELVELLWRNGQVVLHSQTNRKP 49 >ref|XP_002306764.2| hypothetical protein POPTR_0005s22870g [Populus trichocarpa] gi|550339563|gb|EEE93760.2| hypothetical protein POPTR_0005s22870g [Populus trichocarpa] Length = 551 Score = 41.2 bits (95), Expect(2) = 2e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = -2 Query: 844 PYNKVVELLWQDGHVVIHSQNYQKPHPLLANQD 746 P N +VELLW++G VV+HSQ ++KP P + D Sbjct: 38 PGNDLVELLWRNGQVVLHSQAHRKPSPHVQKHD 70 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = -1 Query: 743 VHRQEMP-LKCGVTLGNSGNRIQEADSLGWFGYPIGNSLKKELFSDFFCEI 594 V + + P +K ++ NS + IQ+ D++ W YP+ +S +KE S+FF E+ Sbjct: 66 VQKHDSPTVKGSGSILNSSHLIQDDDAVSWIQYPLEDSFEKEFCSNFFSEL 116