BLASTX nr result
ID: Stemona21_contig00004555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00004555 (365 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001237174.1| uncharacterized protein LOC100306077 [Glycin... 66 5e-09 >ref|NP_001237174.1| uncharacterized protein LOC100306077 [Glycine max] gi|255627461|gb|ACU14075.1| unknown [Glycine max] Length = 142 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 258 QLFEACFSLAFWIFKTFLTIFCSSTRKARMILSLTA 365 Q FEACFS AFWIFKTF TIFC ST+KAR+ILSLTA Sbjct: 74 QAFEACFSFAFWIFKTFFTIFCPSTKKARIILSLTA 109