BLASTX nr result
ID: Stemona21_contig00004298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00004298 (873 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630154.1| 26S proteasome non-ATPase regulatory subunit... 47 1e-09 ref|XP_003531394.2| PREDICTED: 26S proteasome non-ATPase regulat... 47 2e-09 ref|XP_003525095.1| PREDICTED: 26S proteasome non-ATPase regulat... 47 2e-09 ref|XP_002310051.1| 26S proteasome regulatory subunit family pro... 47 3e-09 gb|ABK95699.1| unknown [Populus trichocarpa] 47 3e-09 ref|XP_006427890.1| hypothetical protein CICLE_v10025611mg [Citr... 47 5e-09 ref|XP_006581743.1| PREDICTED: 26S proteasome non-ATPase regulat... 44 5e-09 ref|XP_003526842.1| PREDICTED: 26S proteasome non-ATPase regulat... 44 5e-09 gb|EOY09838.1| 26S proteasome regulatory subunit (RPN5), putativ... 45 8e-09 gb|EOY09837.1| 26S proteasome regulatory subunit (RPN5), putativ... 45 8e-09 gb|EOY09839.1| 26S proteasome regulatory subunit (RPN5), putativ... 45 8e-09 gb|EMJ19349.1| hypothetical protein PRUPE_ppa007373mg [Prunus pe... 44 1e-08 ref|XP_003630159.1| 26S proteasome non-ATPase regulatory subunit... 46 2e-08 ref|XP_006650904.1| PREDICTED: 26S proteasome non-ATPase regulat... 44 2e-08 gb|ACJ85559.1| unknown [Medicago truncatula] gi|388501898|gb|AFK... 46 2e-08 ref|XP_004503985.1| PREDICTED: 26S proteasome non-ATPase regulat... 45 2e-08 gb|EMS63228.1| 26S proteasome non-ATPase regulatory subunit 12 [... 45 2e-08 ref|XP_004148457.1| PREDICTED: 26S proteasome non-ATPase regulat... 45 2e-08 ref|XP_003562457.1| PREDICTED: 26S proteasome non-ATPase regulat... 44 2e-08 gb|EMT03489.1| hypothetical protein F775_32137 [Aegilops tauschii] 44 3e-08 >ref|XP_003630154.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] gi|355524176|gb|AET04630.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] Length = 484 Score = 47.4 bits (111), Expect(2) = 1e-09 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 +EK KEG+N++EEA AD+P L+LK I YELM RY Sbjct: 186 KEKPKEGDNMVEEAPADIPSLLELKQIYYELMIRY 220 Score = 42.4 bits (98), Expect(2) = 1e-09 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QDH+ AQILSRKISPRVFD S+E Sbjct: 158 LDRQDHVRAQILSRKISPRVFDIDASKE 185 >ref|XP_003531394.2| PREDICTED: 26S proteasome non-ATPase regulatory subunit 12 homolog A-like [Glycine max] Length = 480 Score = 47.0 bits (110), Expect(2) = 2e-09 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+NV+EEA AD+P L+LK I YELM RY Sbjct: 228 KKKPKEGDNVVEEAPADIPSLLELKQIYYELMIRY 262 Score = 42.4 bits (98), Expect(2) = 2e-09 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA +S+E Sbjct: 200 LDRQDYVRAQILSRKISPRVFDADLSKE 227 >ref|XP_003525095.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 12 homolog A-like [Glycine max] Length = 441 Score = 47.0 bits (110), Expect(2) = 2e-09 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+NV+EEA AD+P L+LK I YELM RY Sbjct: 189 KKKPKEGDNVVEEAPADIPSLLELKQIYYELMIRY 223 Score = 42.4 bits (98), Expect(2) = 2e-09 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA +S+E Sbjct: 161 LDRQDYVRAQILSRKISPRVFDADLSKE 188 >ref|XP_002310051.1| 26S proteasome regulatory subunit family protein [Populus trichocarpa] gi|222852954|gb|EEE90501.1| 26S proteasome regulatory subunit family protein [Populus trichocarpa] Length = 442 Score = 46.6 bits (109), Expect(2) = 3e-09 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+NV+EEA AD+P L+LK I YELM RY Sbjct: 189 KKKPKEGDNVVEEAPADIPSLLELKRIYYELMIRY 223 Score = 42.0 bits (97), Expect(2) = 3e-09 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA S+E Sbjct: 161 LDRQDYVRAQILSRKISPRVFDADTSKE 188 >gb|ABK95699.1| unknown [Populus trichocarpa] Length = 442 Score = 46.6 bits (109), Expect(2) = 3e-09 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+NV+EEA AD+P L+LK I YELM RY Sbjct: 189 KKKPKEGDNVVEEAPADIPSLLELKRIYYELMIRY 223 Score = 42.0 bits (97), Expect(2) = 3e-09 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA S+E Sbjct: 161 LDRQDYVRAQILSRKISPRVFDADASKE 188 >ref|XP_006427890.1| hypothetical protein CICLE_v10025611mg [Citrus clementina] gi|567870539|ref|XP_006427891.1| hypothetical protein CICLE_v10025611mg [Citrus clementina] gi|568820043|ref|XP_006464541.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 12 homolog A-like [Citrus sinensis] gi|557529880|gb|ESR41130.1| hypothetical protein CICLE_v10025611mg [Citrus clementina] gi|557529881|gb|ESR41131.1| hypothetical protein CICLE_v10025611mg [Citrus clementina] Length = 442 Score = 46.6 bits (109), Expect(2) = 5e-09 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+NV+EEA AD+P L+LK I YELM RY Sbjct: 189 KKKPKEGDNVVEEAPADIPSLLELKRIYYELMIRY 223 Score = 41.2 bits (95), Expect(2) = 5e-09 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA S+E Sbjct: 161 LDRQDYVRAQILSRKISPRVFDADPSKE 188 >ref|XP_006581743.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 12 homolog A-like isoform X2 [Glycine max] Length = 448 Score = 43.9 bits (102), Expect(2) = 5e-09 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LDCQD++ AQILSRKIS RVFDA V++E Sbjct: 168 LDCQDYVRAQILSRKISTRVFDADVTKE 195 Score = 43.9 bits (102), Expect(2) = 5e-09 Identities = 21/35 (60%), Positives = 27/35 (77%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+NV+EEA AD+P +LK I YELM RY Sbjct: 196 KKKPKEGDNVVEEAPADIPSLPELKRIYYELMIRY 230 >ref|XP_003526842.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 12 homolog A-like isoform X1 [Glycine max] Length = 443 Score = 43.9 bits (102), Expect(2) = 5e-09 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LDCQD++ AQILSRKIS RVFDA V++E Sbjct: 163 LDCQDYVRAQILSRKISTRVFDADVTKE 190 Score = 43.9 bits (102), Expect(2) = 5e-09 Identities = 21/35 (60%), Positives = 27/35 (77%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+NV+EEA AD+P +LK I YELM RY Sbjct: 191 KKKPKEGDNVVEEAPADIPSLPELKRIYYELMIRY 225 >gb|EOY09838.1| 26S proteasome regulatory subunit (RPN5), putative isoform 2 [Theobroma cacao] Length = 444 Score = 45.1 bits (105), Expect(2) = 8e-09 Identities = 21/37 (56%), Positives = 28/37 (75%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERYAY 335 ++K KEG+NV+EE AD+P L+LK I YELM RY + Sbjct: 190 KKKPKEGDNVVEEPPADIPSLLELKRIYYELMIRYYF 226 Score = 42.0 bits (97), Expect(2) = 8e-09 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA S+E Sbjct: 162 LDRQDYVRAQILSRKISPRVFDADTSKE 189 >gb|EOY09837.1| 26S proteasome regulatory subunit (RPN5), putative isoform 1 [Theobroma cacao] gi|508717943|gb|EOY09840.1| 26S proteasome regulatory subunit (RPN5), putative isoform 1 [Theobroma cacao] Length = 443 Score = 45.1 bits (105), Expect(2) = 8e-09 Identities = 21/37 (56%), Positives = 28/37 (75%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERYAY 335 ++K KEG+NV+EE AD+P L+LK I YELM RY + Sbjct: 190 KKKPKEGDNVVEEPPADIPSLLELKRIYYELMIRYYF 226 Score = 42.0 bits (97), Expect(2) = 8e-09 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA S+E Sbjct: 162 LDRQDYVRAQILSRKISPRVFDADTSKE 189 >gb|EOY09839.1| 26S proteasome regulatory subunit (RPN5), putative isoform 3 [Theobroma cacao] Length = 441 Score = 45.1 bits (105), Expect(2) = 8e-09 Identities = 21/37 (56%), Positives = 28/37 (75%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERYAY 335 ++K KEG+NV+EE AD+P L+LK I YELM RY + Sbjct: 190 KKKPKEGDNVVEEPPADIPSLLELKRIYYELMIRYYF 226 Score = 42.0 bits (97), Expect(2) = 8e-09 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA S+E Sbjct: 162 LDRQDYVRAQILSRKISPRVFDADTSKE 189 >gb|EMJ19349.1| hypothetical protein PRUPE_ppa007373mg [Prunus persica] Length = 370 Score = 43.9 bits (102), Expect(2) = 1e-08 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERYAY 335 ++K KEG+N++EEA AD+P L+LK I YELM Y + Sbjct: 125 KKKSKEGDNIVEEAPADIPSLLELKRIYYELMIWYYF 161 Score = 42.7 bits (99), Expect(2) = 1e-08 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LDCQD++ AQILSRKISPRVFD ++E Sbjct: 97 LDCQDYVRAQILSRKISPRVFDIDPAKE 124 >ref|XP_003630159.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] gi|355524181|gb|AET04635.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] Length = 455 Score = 45.8 bits (107), Expect(2) = 2e-08 Identities = 21/35 (60%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+N++EEA AD+P L+LK I YELM RY Sbjct: 189 KKKPKEGDNMVEEAPADIPSLLELKQIYYELMIRY 223 Score = 40.0 bits (92), Expect(2) = 2e-08 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFD S+E Sbjct: 161 LDRQDYVRAQILSRKISPRVFDIDASKE 188 >ref|XP_006650904.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 12 homolog A-like [Oryza brachyantha] Length = 443 Score = 43.5 bits (101), Expect(2) = 2e-08 Identities = 19/35 (54%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+N+++EA A++P L+LK I YELM RY Sbjct: 190 KKKPKEGDNIVQEAPAEIPSLLELKRIYYELMIRY 224 Score = 42.4 bits (98), Expect(2) = 2e-08 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA +S+E Sbjct: 162 LDRQDYVRAQILSRKISPRVFDADLSKE 189 >gb|ACJ85559.1| unknown [Medicago truncatula] gi|388501898|gb|AFK39015.1| unknown [Medicago truncatula] gi|388507790|gb|AFK41961.1| unknown [Medicago truncatula] Length = 441 Score = 45.8 bits (107), Expect(2) = 2e-08 Identities = 21/35 (60%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+N++EEA AD+P L+LK I YELM RY Sbjct: 189 KKKPKEGDNMVEEAPADIPSLLELKQIYYELMIRY 223 Score = 40.0 bits (92), Expect(2) = 2e-08 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFD S+E Sbjct: 161 LDRQDYVRAQILSRKISPRVFDIDASKE 188 >ref|XP_004503985.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 12-like [Cicer arietinum] Length = 441 Score = 45.4 bits (106), Expect(2) = 2e-08 Identities = 21/35 (60%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+N++EEA AD+P L+LK I YELM RY Sbjct: 189 KKKPKEGDNMVEEAPADIPSLLELKRIYYELMIRY 223 Score = 40.4 bits (93), Expect(2) = 2e-08 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFD S+E Sbjct: 161 LDRQDYVRAQILSRKISPRVFDVDASKE 188 >gb|EMS63228.1| 26S proteasome non-ATPase regulatory subunit 12 [Triticum urartu] Length = 455 Score = 44.7 bits (104), Expect(2) = 2e-08 Identities = 21/35 (60%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+N+++EA ADVP L+LK I YELM RY Sbjct: 202 KKKPKEGDNMVQEAPADVPSLLELKRIYYELMIRY 236 Score = 40.8 bits (94), Expect(2) = 2e-08 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA S++ Sbjct: 174 LDRQDYVRAQILSRKISPRVFDADTSKD 201 >ref|XP_004148457.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 12-like [Cucumis sativus] gi|449527286|ref|XP_004170643.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 12-like [Cucumis sativus] Length = 442 Score = 45.4 bits (106), Expect(2) = 2e-08 Identities = 20/35 (57%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+N++EEA AD+P ++LK I YELM RY Sbjct: 189 KKKPKEGDNIVEEAPADIPSLMELKRIYYELMIRY 223 Score = 40.0 bits (92), Expect(2) = 2e-08 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA ++E Sbjct: 161 LDRQDYVRAQILSRKISPRVFDADPTKE 188 >ref|XP_003562457.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 12-like [Brachypodium distachyon] Length = 442 Score = 43.5 bits (101), Expect(2) = 2e-08 Identities = 19/35 (54%), Positives = 28/35 (80%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 ++K KEG+N+++EA A++P L+LK I YELM RY Sbjct: 189 KKKPKEGDNIVQEAPAEIPSLLELKRIYYELMIRY 223 Score = 42.0 bits (97), Expect(2) = 2e-08 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA S+E Sbjct: 161 LDHQDYVRAQILSRKISPRVFDADTSKE 188 >gb|EMT03489.1| hypothetical protein F775_32137 [Aegilops tauschii] Length = 464 Score = 44.3 bits (103), Expect(2) = 3e-08 Identities = 21/35 (60%), Positives = 27/35 (77%) Frame = -3 Query: 445 EEKLKEGENVIEEAFADVPLFLQLKSIAYELMERY 341 + K KEG+N+++EA ADVP L+LK I YELM RY Sbjct: 211 KRKPKEGDNMVQEAPADVPSLLELKRIYYELMIRY 245 Score = 40.8 bits (94), Expect(2) = 3e-08 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -1 Query: 528 LDCQDHL*AQILSRKISPRVFDAHVSQE 445 LD QD++ AQILSRKISPRVFDA S++ Sbjct: 183 LDRQDYVRAQILSRKISPRVFDADTSKD 210