BLASTX nr result
ID: Stemona21_contig00004242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00004242 (361 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309664.2| hypothetical protein POPTR_0006s27760g [Popu... 59 5e-07 ref|XP_002324901.2| hypothetical protein POPTR_0018s02320g [Popu... 59 7e-07 gb|EXB38646.1| Zinc finger protein 3 [Morus notabilis] 58 1e-06 emb|CAN74885.1| hypothetical protein VITISV_000223 [Vitis vinifera] 58 1e-06 gb|EPS73897.1| hypothetical protein M569_00864 [Genlisea aurea] 57 3e-06 ref|XP_002515449.1| zinc finger protein, putative [Ricinus commu... 57 3e-06 gb|EOY29371.1| C2H2 and C2HC zinc fingers superfamily protein, p... 56 4e-06 ref|XP_002272545.1| PREDICTED: zinc finger protein 1-like [Vitis... 56 4e-06 gb|ESW33142.1| hypothetical protein PHAVU_001G046500g [Phaseolus... 55 7e-06 gb|EOY26013.1| Zinc finger protein, putative [Theobroma cacao] 55 7e-06 gb|AFK46872.1| unknown [Lotus japonicus] 55 7e-06 ref|XP_002297800.2| hypothetical protein POPTR_0001s14780g [Popu... 55 1e-05 >ref|XP_002309664.2| hypothetical protein POPTR_0006s27760g [Populus trichocarpa] gi|550337218|gb|EEE93187.2| hypothetical protein POPTR_0006s27760g [Populus trichocarpa] Length = 260 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 259 PQLPQGSPEPEQRVFSCNFCRRKFYSSQALGGHQ 360 P+ PQG+ + EQRVFSCN+C+RKFYSSQALGGHQ Sbjct: 86 PETPQGT-DAEQRVFSCNYCQRKFYSSQALGGHQ 118 >ref|XP_002324901.2| hypothetical protein POPTR_0018s02320g [Populus trichocarpa] gi|550317864|gb|EEF03466.2| hypothetical protein POPTR_0018s02320g [Populus trichocarpa] Length = 252 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 259 PQLPQGSPEPEQRVFSCNFCRRKFYSSQALGGHQ 360 P+ PQG+ + EQRVFSCN+C+RKFYSSQALGGHQ Sbjct: 79 PETPQGT-DGEQRVFSCNYCQRKFYSSQALGGHQ 111 >gb|EXB38646.1| Zinc finger protein 3 [Morus notabilis] Length = 290 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 271 QGSPEPEQRVFSCNFCRRKFYSSQALGGHQ 360 QGS EQRVFSCN+C+RKFYSSQALGGHQ Sbjct: 104 QGSDNSEQRVFSCNYCQRKFYSSQALGGHQ 133 >emb|CAN74885.1| hypothetical protein VITISV_000223 [Vitis vinifera] Length = 267 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 256 QPQLPQGSPEPEQRVFSCNFCRRKFYSSQALGGHQ 360 Q ++PQG+ E E RVFSCN+C+RKFYSSQALGGHQ Sbjct: 87 QSEIPQGN-EGEPRVFSCNYCQRKFYSSQALGGHQ 120 >gb|EPS73897.1| hypothetical protein M569_00864 [Genlisea aurea] Length = 119 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 280 PEPEQRVFSCNFCRRKFYSSQALGGHQ 360 P EQRVFSCN+CRRKFYSSQALGGHQ Sbjct: 27 PATEQRVFSCNYCRRKFYSSQALGGHQ 53 >ref|XP_002515449.1| zinc finger protein, putative [Ricinus communis] gi|223545393|gb|EEF46898.1| zinc finger protein, putative [Ricinus communis] Length = 253 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +1 Query: 250 VQQPQLPQGSPEPEQRVFSCNFCRRKFYSSQALGGHQ 360 V PQ + + EQR+FSCN+C+RKFYSS+ALGGHQ Sbjct: 69 VDSSDTPQANTDVEQRIFSCNYCQRKFYSSKALGGHQ 105 >gb|EOY29371.1| C2H2 and C2HC zinc fingers superfamily protein, putative [Theobroma cacao] Length = 268 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 259 PQLPQGSPEPEQRVFSCNFCRRKFYSSQALGGHQ 360 P+ PQ + + EQRVFSCN+C+RKFYSSQALGGHQ Sbjct: 75 PETPQPT-DAEQRVFSCNYCQRKFYSSQALGGHQ 107 >ref|XP_002272545.1| PREDICTED: zinc finger protein 1-like [Vitis vinifera] Length = 267 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 262 QLPQGSPEPEQRVFSCNFCRRKFYSSQALGGHQ 360 ++PQG+ E E RVFSCN+C+RKFYSSQALGGHQ Sbjct: 89 EIPQGN-EGEPRVFSCNYCQRKFYSSQALGGHQ 120 >gb|ESW33142.1| hypothetical protein PHAVU_001G046500g [Phaseolus vulgaris] Length = 288 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +1 Query: 262 QLPQGSPEPEQRVFSCNFCRRKFYSSQALGGHQ 360 + P GS E RVFSCN+C RKFYSSQALGGHQ Sbjct: 95 EAPLGSDAAEPRVFSCNYCHRKFYSSQALGGHQ 127 >gb|EOY26013.1| Zinc finger protein, putative [Theobroma cacao] Length = 278 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 262 QLPQGSPEPEQRVFSCNFCRRKFYSSQALGGHQ 360 + PQG+ E E RVFSCN+C+RKFYSSQALGGHQ Sbjct: 95 ETPQGN-ETEPRVFSCNYCQRKFYSSQALGGHQ 126 >gb|AFK46872.1| unknown [Lotus japonicus] Length = 293 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 268 PQGSPEPEQRVFSCNFCRRKFYSSQALGGHQ 360 P G E E RVFSCN+C RKFYSSQALGGHQ Sbjct: 95 PLGCSEAEPRVFSCNYCHRKFYSSQALGGHQ 125 >ref|XP_002297800.2| hypothetical protein POPTR_0001s14780g [Populus trichocarpa] gi|550347273|gb|EEE82605.2| hypothetical protein POPTR_0001s14780g [Populus trichocarpa] Length = 286 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 268 PQGSPEPEQRVFSCNFCRRKFYSSQALGGHQ 360 PQG+ E E RVFSCN+C+RKFYSSQALGGHQ Sbjct: 102 PQGN-ETEPRVFSCNYCQRKFYSSQALGGHQ 131