BLASTX nr result
ID: Stemona21_contig00004121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00004121 (1577 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW83455.1| putative ubiquitin-conjugating enzyme family [Zea... 149 2e-33 ref|XP_002274367.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 147 1e-32 ref|NP_001234247.1| ubiquitin-conjugating enzyme E2-17 kDa [Sola... 146 3e-32 ref|XP_006452759.1| hypothetical protein CICLE_v10009806mg [Citr... 146 3e-32 ref|XP_006452758.1| hypothetical protein CICLE_v10009806mg [Citr... 146 3e-32 ref|XP_006452757.1| hypothetical protein CICLE_v10009806mg [Citr... 146 3e-32 ref|NP_001275336.1| ubiquitin-conjugating enzyme E2-17 kDa-like ... 146 3e-32 ref|XP_003632627.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 146 3e-32 ref|XP_002330576.1| predicted protein [Populus trichocarpa] gi|5... 146 3e-32 gb|ABQ41978.1| ubiquitin-conjugating enzyme [Sonneratia caseolar... 146 3e-32 gb|ABQ41977.1| ubiquitin-conjugating enzyme [Sonneratia alba] 146 3e-32 ref|XP_002284203.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 146 3e-32 gb|AAR83898.1| ubiquitin-conjugating protein [Capsicum annuum] 146 3e-32 ref|XP_006601774.1| PREDICTED: uncharacterized protein LOC100527... 145 4e-32 gb|EOY11849.1| Ubiquitin-conjugating enzyme 28 isoform 1 [Theobr... 145 4e-32 gb|EMT13517.1| Ubiquitin carrier protein E2 28 [Aegilops tauschii] 145 4e-32 dbj|BAJ96360.1| predicted protein [Hordeum vulgare subsp. vulgar... 145 4e-32 gb|ADK73584.1| ubiquitin-conjugating enzyme E2 [Oryza grandiglumis] 145 4e-32 gb|EAZ32338.1| hypothetical protein OsJ_16548 [Oryza sativa Japo... 145 4e-32 ref|XP_003580772.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 145 4e-32 >gb|AFW83455.1| putative ubiquitin-conjugating enzyme family [Zea mays] Length = 120 Score = 149 bits (377), Expect = 2e-33 Identities = 69/80 (86%), Positives = 76/80 (95%) Frame = +1 Query: 1333 NYSSINHFHFQVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNP 1512 +Y +++H + QV+FRTKVFHPNINSNGSICLDILK+QWSPALTISKVLLSICSLLTDPNP Sbjct: 29 SYKTLSHSNMQVAFRTKVFHPNINSNGSICLDILKDQWSPALTISKVLLSICSLLTDPNP 88 Query: 1513 DDPLVPEIAHMYKTDRAKYE 1572 DDPLVPEIAHMYKTDR KYE Sbjct: 89 DDPLVPEIAHMYKTDRNKYE 108 >ref|XP_002274367.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform 2 [Vitis vinifera] gi|225462033|ref|XP_002274335.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform 1 [Vitis vinifera] gi|359494225|ref|XP_003634740.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Vitis vinifera] gi|147771931|emb|CAN77946.1| hypothetical protein VITISV_029275 [Vitis vinifera] gi|296089984|emb|CBI39803.3| unnamed protein product [Vitis vinifera] Length = 148 Score = 147 bits (371), Expect = 1e-32 Identities = 70/71 (98%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +VSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYET Sbjct: 126 MYKTDRAKYET 136 >ref|NP_001234247.1| ubiquitin-conjugating enzyme E2-17 kDa [Solanum lycopersicum] gi|568214689|ref|NP_001275127.1| ubiquitin-conjugating enzyme E2-like protein [Solanum tuberosum] gi|460389580|ref|XP_004240429.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 1 [Solanum lycopersicum] gi|460389582|ref|XP_004240430.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 2 [Solanum lycopersicum] gi|460389584|ref|XP_004240431.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 3 [Solanum lycopersicum] gi|460389586|ref|XP_004240432.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 4 [Solanum lycopersicum] gi|565354369|ref|XP_006344083.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Solanum tuberosum] gi|565368518|ref|XP_006350891.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform X1 [Solanum tuberosum] gi|464981|sp|P35135.1|UBC4_SOLLC RecName: Full=Ubiquitin-conjugating enzyme E2-17 kDa; AltName: Full=Ubiquitin carrier protein; AltName: Full=Ubiquitin-protein ligase gi|388207|gb|AAA34125.1| ubiquitin carrier protein [Solanum lycopersicum] gi|83283973|gb|ABC01894.1| ubiquitin-conjugating enzyme E2-like protein [Solanum tuberosum] gi|213494485|gb|ACJ48964.1| ubiquitin conjugating enzyme [Solanum lycopersicum] Length = 148 Score = 146 bits (368), Expect = 3e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +V+FRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYET Sbjct: 126 MYKTDRAKYET 136 >ref|XP_006452759.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] gi|567921508|ref|XP_006452760.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] gi|568841647|ref|XP_006474769.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform X1 [Citrus sinensis] gi|557555985|gb|ESR65999.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] gi|557555986|gb|ESR66000.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] Length = 148 Score = 146 bits (368), Expect = 3e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +V+FRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYET Sbjct: 126 MYKTDRAKYET 136 >ref|XP_006452758.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] gi|557555984|gb|ESR65998.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] Length = 137 Score = 146 bits (368), Expect = 3e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +V+FRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 55 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 114 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYET Sbjct: 115 MYKTDRAKYET 125 >ref|XP_006452757.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] gi|568841649|ref|XP_006474770.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform X2 [Citrus sinensis] gi|557555983|gb|ESR65997.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] Length = 119 Score = 146 bits (368), Expect = 3e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +V+FRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 37 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 96 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYET Sbjct: 97 MYKTDRAKYET 107 >ref|NP_001275336.1| ubiquitin-conjugating enzyme E2-17 kDa-like [Solanum tuberosum] gi|82621144|gb|ABB86260.1| ubiquitin-conjugating protein-like [Solanum tuberosum] Length = 118 Score = 146 bits (368), Expect = 3e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +V+FRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 36 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 95 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYET Sbjct: 96 MYKTDRAKYET 106 >ref|XP_003632627.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Vitis vinifera] Length = 155 Score = 146 bits (368), Expect = 3e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +V+FRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 73 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 132 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYET Sbjct: 133 MYKTDRAKYET 143 >ref|XP_002330576.1| predicted protein [Populus trichocarpa] gi|566195968|ref|XP_006378000.1| hypothetical protein POPTR_0011s17120g [Populus trichocarpa] gi|566195970|ref|XP_006378001.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] gi|550328606|gb|ERP55797.1| hypothetical protein POPTR_0011s17120g [Populus trichocarpa] gi|550328607|gb|ERP55798.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] Length = 148 Score = 146 bits (368), Expect = 3e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +VSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 1543 MYKTDRAKYET 1575 MYKTDRA+YET Sbjct: 126 MYKTDRARYET 136 >gb|ABQ41978.1| ubiquitin-conjugating enzyme [Sonneratia caseolaris] gi|146454626|gb|ABQ41979.1| ubiquitin-conjugating enzyme [Sonneratia ovata] gi|146454628|gb|ABQ41980.1| ubiquitin-conjugating enzyme [Sonneratia apetala] Length = 114 Score = 146 bits (368), Expect = 3e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +V+FRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 42 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 101 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYET Sbjct: 102 MYKTDRAKYET 112 >gb|ABQ41977.1| ubiquitin-conjugating enzyme [Sonneratia alba] Length = 114 Score = 146 bits (368), Expect = 3e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +V+FRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 42 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 101 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYET Sbjct: 102 MYKTDRAKYET 112 >ref|XP_002284203.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform 2 [Vitis vinifera] gi|225440290|ref|XP_002284197.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform 1 [Vitis vinifera] gi|359489699|ref|XP_003633968.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Vitis vinifera] gi|147803053|emb|CAN77754.1| hypothetical protein VITISV_039341 [Vitis vinifera] gi|147852846|emb|CAN81281.1| hypothetical protein VITISV_016558 [Vitis vinifera] gi|297741756|emb|CBI32888.3| unnamed protein product [Vitis vinifera] gi|297745391|emb|CBI40471.3| unnamed protein product [Vitis vinifera] gi|462415023|gb|EMJ19760.1| hypothetical protein PRUPE_ppa012930mg [Prunus persica] gi|587935648|gb|EXC22515.1| Ubiquitin-conjugating enzyme E2-17 kDa [Morus notabilis] Length = 148 Score = 146 bits (368), Expect = 3e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +V+FRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYET Sbjct: 126 MYKTDRAKYET 136 >gb|AAR83898.1| ubiquitin-conjugating protein [Capsicum annuum] Length = 119 Score = 146 bits (368), Expect = 3e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +V+FRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 37 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 96 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYET Sbjct: 97 MYKTDRAKYET 107 >ref|XP_006601774.1| PREDICTED: uncharacterized protein LOC100527105 isoform X1 [Glycine max] Length = 141 Score = 145 bits (367), Expect = 4e-32 Identities = 68/72 (94%), Positives = 70/72 (97%) Frame = +1 Query: 1357 HFQVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEI 1536 H QV+FRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEI Sbjct: 57 HIQVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEI 116 Query: 1537 AHMYKTDRAKYE 1572 AHMYK D+AKYE Sbjct: 117 AHMYKADKAKYE 128 >gb|EOY11849.1| Ubiquitin-conjugating enzyme 28 isoform 1 [Theobroma cacao] Length = 148 Score = 145 bits (367), Expect = 4e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +VSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYE+ Sbjct: 126 MYKTDRAKYES 136 >gb|EMT13517.1| Ubiquitin carrier protein E2 28 [Aegilops tauschii] Length = 183 Score = 145 bits (367), Expect = 4e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +VSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 101 KVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 160 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYE+ Sbjct: 161 MYKTDRAKYES 171 >dbj|BAJ96360.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326532154|dbj|BAK01453.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 148 Score = 145 bits (367), Expect = 4e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +VSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYE+ Sbjct: 126 MYKTDRAKYES 136 >gb|ADK73584.1| ubiquitin-conjugating enzyme E2 [Oryza grandiglumis] Length = 148 Score = 145 bits (367), Expect = 4e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +VSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYE+ Sbjct: 126 MYKTDRAKYES 136 >gb|EAZ32338.1| hypothetical protein OsJ_16548 [Oryza sativa Japonica Group] Length = 203 Score = 145 bits (367), Expect = 4e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +VSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYE+ Sbjct: 126 MYKTDRAKYES 136 >ref|XP_003580772.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Brachypodium distachyon] gi|52548244|gb|AAU82109.1| ubiquitin-conjugating enzyme [Triticum aestivum] gi|474413037|gb|EMS66952.1| Ubiquitin-conjugating enzyme E2 28 [Triticum urartu] Length = 148 Score = 145 bits (367), Expect = 4e-32 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = +1 Query: 1363 QVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 1542 +VSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVSFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 1543 MYKTDRAKYET 1575 MYKTDRAKYE+ Sbjct: 126 MYKTDRAKYES 136