BLASTX nr result
ID: Stemona21_contig00003473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00003473 (514 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516569.1| Coiled-coil domain-containing protein, putat... 71 1e-10 ref|XP_006833314.1| hypothetical protein AMTR_s00109p00055760 [A... 71 2e-10 emb|CBI20890.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_002284173.1| PREDICTED: coiled-coil domain-containing pro... 70 2e-10 emb|CAN72066.1| hypothetical protein VITISV_042589 [Vitis vinifera] 70 2e-10 gb|EOY29676.1| Uncharacterized protein TCM_037150 [Theobroma cacao] 70 3e-10 gb|EMJ24618.1| hypothetical protein PRUPE_ppa011315mg [Prunus pe... 69 6e-10 ref|XP_004136294.1| PREDICTED: coiled-coil domain-containing pro... 69 8e-10 ref|XP_006450631.1| hypothetical protein CICLE_v10009455mg [Citr... 68 1e-09 ref|XP_002309559.1| hypothetical protein POPTR_0006s25860g [Popu... 68 1e-09 ref|XP_004291205.1| PREDICTED: coiled-coil domain-containing pro... 67 2e-09 ref|XP_004168636.1| PREDICTED: coiled-coil domain-containing pro... 67 2e-09 ref|XP_004960640.1| PREDICTED: coiled-coil domain-containing pro... 66 4e-09 gb|EXC22695.1| hypothetical protein L484_001798 [Morus notabilis] 66 5e-09 ref|XP_006399656.1| hypothetical protein EUTSA_v10014652mg [Eutr... 65 7e-09 ref|XP_006288641.1| hypothetical protein CARUB_v10001946mg [Caps... 65 7e-09 gb|ABX10747.1| unknown [Brassica juncea] 65 7e-09 gb|AFW82081.1| hypothetical protein ZEAMMB73_801243, partial [Ze... 65 9e-09 ref|XP_002440815.1| hypothetical protein SORBIDRAFT_09g007310 [S... 65 9e-09 gb|ACR35873.1| unknown [Zea mays] gi|413949433|gb|AFW82082.1| hy... 65 9e-09 >ref|XP_002516569.1| Coiled-coil domain-containing protein, putative [Ricinus communis] gi|223544389|gb|EEF45910.1| Coiled-coil domain-containing protein, putative [Ricinus communis] Length = 215 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAEIRSYKGLMVSEKMTSNKQIAS NKSLQELEEDFM Sbjct: 179 QAEIRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 215 >ref|XP_006833314.1| hypothetical protein AMTR_s00109p00055760 [Amborella trichopoda] gi|548837990|gb|ERM98592.1| hypothetical protein AMTR_s00109p00055760 [Amborella trichopoda] Length = 215 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 Q EIRSYKGLMVS+KMTSNKQIASTNKSLQELEEDFM Sbjct: 179 QVEIRSYKGLMVSDKMTSNKQIASTNKSLQELEEDFM 215 >emb|CBI20890.3| unnamed protein product [Vitis vinifera] Length = 198 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAEIRSYKGLMVSEKMTSNKQIAS NKSLQELE+DFM Sbjct: 162 QAEIRSYKGLMVSEKMTSNKQIASANKSLQELEDDFM 198 >ref|XP_002284173.1| PREDICTED: coiled-coil domain-containing protein 25-like [Vitis vinifera] Length = 215 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAEIRSYKGLMVSEKMTSNKQIAS NKSLQELE+DFM Sbjct: 179 QAEIRSYKGLMVSEKMTSNKQIASANKSLQELEDDFM 215 >emb|CAN72066.1| hypothetical protein VITISV_042589 [Vitis vinifera] Length = 199 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAEIRSYKGLMVSEKMTSNKQIAS NKSLQELE+DFM Sbjct: 163 QAEIRSYKGLMVSEKMTSNKQIASANKSLQELEDDFM 199 >gb|EOY29676.1| Uncharacterized protein TCM_037150 [Theobroma cacao] Length = 215 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAEIRSYKGLMVSEKMTSNKQIA T+KSLQELEEDFM Sbjct: 179 QAEIRSYKGLMVSEKMTSNKQIAETSKSLQELEEDFM 215 >gb|EMJ24618.1| hypothetical protein PRUPE_ppa011315mg [Prunus persica] Length = 215 Score = 68.9 bits (167), Expect = 6e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAE+RSYKGLMVSE MTSNKQIAS NKSLQELEEDFM Sbjct: 179 QAELRSYKGLMVSENMTSNKQIASANKSLQELEEDFM 215 >ref|XP_004136294.1| PREDICTED: coiled-coil domain-containing protein 25-like [Cucumis sativus] Length = 215 Score = 68.6 bits (166), Expect = 8e-10 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAE+RSYKGLMVSEKMTSNKQIA+T+KSLQELE+DFM Sbjct: 179 QAELRSYKGLMVSEKMTSNKQIAATSKSLQELEDDFM 215 >ref|XP_006450631.1| hypothetical protein CICLE_v10009455mg [Citrus clementina] gi|568844433|ref|XP_006476093.1| PREDICTED: coiled-coil domain-containing protein 25-like [Citrus sinensis] gi|557553857|gb|ESR63871.1| hypothetical protein CICLE_v10009455mg [Citrus clementina] Length = 215 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAE+RSYKGLMV+EKMTSNKQIAS +KSLQELEEDFM Sbjct: 179 QAEVRSYKGLMVAEKMTSNKQIASESKSLQELEEDFM 215 >ref|XP_002309559.1| hypothetical protein POPTR_0006s25860g [Populus trichocarpa] gi|222855535|gb|EEE93082.1| hypothetical protein POPTR_0006s25860g [Populus trichocarpa] Length = 215 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAE+RSYKGLMV+EKMTSNKQIAS NKSLQELE+DFM Sbjct: 179 QAEMRSYKGLMVAEKMTSNKQIASENKSLQELEDDFM 215 >ref|XP_004291205.1| PREDICTED: coiled-coil domain-containing protein 25-like [Fragaria vesca subsp. vesca] Length = 215 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAE+RSYKGLMV E MTSNKQIAS NKSLQELEEDFM Sbjct: 179 QAELRSYKGLMVHENMTSNKQIASANKSLQELEEDFM 215 >ref|XP_004168636.1| PREDICTED: coiled-coil domain-containing protein 25-like [Cucumis sativus] Length = 215 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 Q E+RSYKGLMVSEKMTSNKQIA+T+KSLQELE+DFM Sbjct: 179 QVELRSYKGLMVSEKMTSNKQIAATSKSLQELEDDFM 215 >ref|XP_004960640.1| PREDICTED: coiled-coil domain-containing protein 25-like [Setaria italica] Length = 215 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAEIRSYKGLMV EKMTSNKQIAS +K+LQELEEDFM Sbjct: 179 QAEIRSYKGLMVQEKMTSNKQIASGSKTLQELEEDFM 215 >gb|EXC22695.1| hypothetical protein L484_001798 [Morus notabilis] Length = 215 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 Q E+RSYKGLMVSE MTSNKQIA+T+KSLQELEEDFM Sbjct: 179 QLELRSYKGLMVSENMTSNKQIAATSKSLQELEEDFM 215 >ref|XP_006399656.1| hypothetical protein EUTSA_v10014652mg [Eutrema salsugineum] gi|557100746|gb|ESQ41109.1| hypothetical protein EUTSA_v10014652mg [Eutrema salsugineum] Length = 215 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAE+RSYKGLMV++KMTSNK IAS+NKSLQELE+DFM Sbjct: 179 QAEMRSYKGLMVTDKMTSNKDIASSNKSLQELEDDFM 215 >ref|XP_006288641.1| hypothetical protein CARUB_v10001946mg [Capsella rubella] gi|482557347|gb|EOA21539.1| hypothetical protein CARUB_v10001946mg [Capsella rubella] Length = 215 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAE+RSYKGLMV++KMTSNK IAS+NKSLQELE+DFM Sbjct: 179 QAEMRSYKGLMVTDKMTSNKDIASSNKSLQELEDDFM 215 >gb|ABX10747.1| unknown [Brassica juncea] Length = 215 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QAE+RSYKGLMV++KMTSNK IAS+NKSLQELE+DFM Sbjct: 179 QAEMRSYKGLMVTDKMTSNKDIASSNKSLQELEDDFM 215 >gb|AFW82081.1| hypothetical protein ZEAMMB73_801243, partial [Zea mays] Length = 106 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QA+IRSYKGLMV EKMTSNKQIAS +K+LQELEEDFM Sbjct: 70 QADIRSYKGLMVQEKMTSNKQIASGSKTLQELEEDFM 106 >ref|XP_002440815.1| hypothetical protein SORBIDRAFT_09g007310 [Sorghum bicolor] gi|241946100|gb|EES19245.1| hypothetical protein SORBIDRAFT_09g007310 [Sorghum bicolor] Length = 215 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QA+IRSYKGLMV EKMTSNKQIAS +K+LQELEEDFM Sbjct: 179 QADIRSYKGLMVQEKMTSNKQIASGSKTLQELEEDFM 215 >gb|ACR35873.1| unknown [Zea mays] gi|413949433|gb|AFW82082.1| hypothetical protein ZEAMMB73_801243 [Zea mays] Length = 113 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 453 QAEIRSYKGLMVSEKMTSNKQIASTNKSLQELEEDFM 343 QA+IRSYKGLMV EKMTSNKQIAS +K+LQELEEDFM Sbjct: 77 QADIRSYKGLMVQEKMTSNKQIASGSKTLQELEEDFM 113