BLASTX nr result
ID: Stemona21_contig00003386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00003386 (379 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS56300.1| Mitochondrial import inner membrane translocase s... 57 3e-06 ref|XP_003574068.1| PREDICTED: mitochondrial import inner membra... 57 3e-06 ref|XP_006374575.1| hypothetical protein POPTR_0015s11790g [Popu... 56 4e-06 ref|XP_006292066.1| hypothetical protein CARUB_v10018261mg [Caps... 56 4e-06 dbj|BAJ98555.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 4e-06 ref|XP_002878264.1| hypothetical protein ARALYDRAFT_907429 [Arab... 56 4e-06 ref|XP_002322306.1| hypothetical protein POPTR_0015s11790g [Popu... 56 4e-06 ref|XP_002318780.1| magmas-like family protein [Populus trichoca... 56 4e-06 emb|CAB91598.1| putative protein [Arabidopsis thaliana] 56 4e-06 ref|NP_567078.1| protein THAXTOMIN A RESISTANT 1 [Arabidopsis th... 56 4e-06 ref|XP_006661864.1| PREDICTED: mitochondrial import inner membra... 55 1e-05 gb|AAG13579.1|AC037425_10 putative pol polyprotein [Oryza sativa... 55 1e-05 ref|NP_001064869.1| Os10g0479600 [Oryza sativa Japonica Group] g... 55 1e-05 ref|XP_002467071.1| hypothetical protein SORBIDRAFT_01g019160 [S... 55 1e-05 gb|EEC67178.1| hypothetical protein OsI_34046 [Oryza sativa Indi... 55 1e-05 >gb|EMS56300.1| Mitochondrial import inner membrane translocase subunit tim16 [Triticum urartu] Length = 124 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 Q+YDKLFE+NA SGSFYLQSKVHRAK+C E Sbjct: 82 QRYDKLFERNATSGSFYLQSKVHRAKECLE 111 >ref|XP_003574068.1| PREDICTED: mitochondrial import inner membrane translocase subunit tim16-like [Brachypodium distachyon] Length = 116 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 Q+YDKLFE+NA SGSFYLQSKVHRAK+C E Sbjct: 74 QRYDKLFERNATSGSFYLQSKVHRAKECLE 103 >ref|XP_006374575.1| hypothetical protein POPTR_0015s11790g [Populus trichocarpa] gi|550322519|gb|ERP52372.1| hypothetical protein POPTR_0015s11790g [Populus trichocarpa] Length = 103 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 QKYDKLFE NA +GSFYLQSKVHRAK+C E Sbjct: 63 QKYDKLFENNAKNGSFYLQSKVHRAKECLE 92 >ref|XP_006292066.1| hypothetical protein CARUB_v10018261mg [Capsella rubella] gi|482560773|gb|EOA24964.1| hypothetical protein CARUB_v10018261mg [Capsella rubella] Length = 116 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 QKYDKLFE NA +GSFYLQSKVHRAK+C E Sbjct: 75 QKYDKLFENNAKAGSFYLQSKVHRAKECLE 104 >dbj|BAJ98555.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 114 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 QKYD +FEKNA SGSFYLQSKVHRAK+C E Sbjct: 74 QKYDTMFEKNAKSGSFYLQSKVHRAKECLE 103 >ref|XP_002878264.1| hypothetical protein ARALYDRAFT_907429 [Arabidopsis lyrata subsp. lyrata] gi|297324102|gb|EFH54523.1| hypothetical protein ARALYDRAFT_907429 [Arabidopsis lyrata subsp. lyrata] Length = 116 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 QKYDKLFE NA +GSFYLQSKVHRAK+C E Sbjct: 75 QKYDKLFENNAKAGSFYLQSKVHRAKECLE 104 >ref|XP_002322306.1| hypothetical protein POPTR_0015s11790g [Populus trichocarpa] gi|222869302|gb|EEF06433.1| hypothetical protein POPTR_0015s11790g [Populus trichocarpa] Length = 114 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 QKYDKLFE NA +GSFYLQSKVHRAK+C E Sbjct: 74 QKYDKLFENNAKNGSFYLQSKVHRAKECLE 103 >ref|XP_002318780.1| magmas-like family protein [Populus trichocarpa] gi|222859453|gb|EEE97000.1| magmas-like family protein [Populus trichocarpa] Length = 114 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 QKYDKLFE NA +GSFYLQSKVHRAK+C E Sbjct: 74 QKYDKLFENNAKNGSFYLQSKVHRAKECLE 103 >emb|CAB91598.1| putative protein [Arabidopsis thaliana] Length = 121 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 QKYDKLFE NA +GSFYLQSKVHRAK+C E Sbjct: 80 QKYDKLFENNAKAGSFYLQSKVHRAKECLE 109 >ref|NP_567078.1| protein THAXTOMIN A RESISTANT 1 [Arabidopsis thaliana] gi|14190487|gb|AAK55724.1|AF380643_1 AT3g59280/F25L23_140 [Arabidopsis thaliana] gi|15809738|gb|AAL06797.1| AT3g59280/F25L23_140 [Arabidopsis thaliana] gi|32306447|gb|AAM63549.1| thaxtomin resistance protein TXR1 [Arabidopsis thaliana] gi|332646378|gb|AEE79899.1| protein transporter, Pam16 [Arabidopsis thaliana] Length = 116 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 QKYDKLFE NA +GSFYLQSKVHRAK+C E Sbjct: 75 QKYDKLFENNAKAGSFYLQSKVHRAKECLE 104 >ref|XP_006661864.1| PREDICTED: mitochondrial import inner membrane translocase subunit tim16-like [Oryza brachyantha] Length = 117 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 Q+YD LFE+NA SGSFYLQSKVHRAK+C E Sbjct: 74 QRYDNLFERNAKSGSFYLQSKVHRAKECLE 103 >gb|AAG13579.1|AC037425_10 putative pol polyprotein [Oryza sativa Japonica Group] Length = 105 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 Q+YD LFE+NA SGSFYLQSKVHRAK+C E Sbjct: 63 QRYDNLFERNAKSGSFYLQSKVHRAKECLE 92 >ref|NP_001064869.1| Os10g0479600 [Oryza sativa Japonica Group] gi|78708818|gb|ABB47793.1| Uncharacterised protein family containing protein, expressed [Oryza sativa Japonica Group] gi|113639478|dbj|BAF26783.1| Os10g0479600 [Oryza sativa Japonica Group] gi|215693233|dbj|BAG88615.1| unnamed protein product [Oryza sativa Japonica Group] Length = 116 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 Q+YD LFE+NA SGSFYLQSKVHRAK+C E Sbjct: 74 QRYDNLFERNAKSGSFYLQSKVHRAKECLE 103 >ref|XP_002467071.1| hypothetical protein SORBIDRAFT_01g019160 [Sorghum bicolor] gi|241920925|gb|EER94069.1| hypothetical protein SORBIDRAFT_01g019160 [Sorghum bicolor] Length = 116 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 Q+YD LFE+NA SGSFYLQSKVHRAK+C E Sbjct: 74 QRYDNLFERNAKSGSFYLQSKVHRAKECLE 103 >gb|EEC67178.1| hypothetical protein OsI_34046 [Oryza sativa Indica Group] gi|222613015|gb|EEE51147.1| hypothetical protein OsJ_31908 [Oryza sativa Japonica Group] Length = 345 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 QKYDKLFEKNAMSGSFYLQSKVHRAKKCYE 91 Q+YD LFE+NA SGSFYLQSKVHRAK+C E Sbjct: 303 QRYDNLFERNAKSGSFYLQSKVHRAKECLE 332