BLASTX nr result
ID: Stemona21_contig00003295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00003295 (417 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277047.1| PREDICTED: zinc finger protein ZPR1 homolog ... 58 1e-06 ref|XP_002277005.1| PREDICTED: zinc finger protein ZPR1 homolog ... 58 1e-06 emb|CAN71442.1| hypothetical protein VITISV_043818 [Vitis vinifera] 58 1e-06 ref|XP_006605520.1| PREDICTED: zinc finger protein ZPR1 homolog ... 58 1e-06 ref|XP_006583933.1| PREDICTED: zinc finger protein ZPR1 isoform ... 58 1e-06 ref|XP_006583932.1| PREDICTED: zinc finger protein ZPR1 isoform ... 58 1e-06 ref|XP_004981682.1| PREDICTED: zinc finger protein ZPR1-like [Se... 58 1e-06 ref|XP_003556397.1| PREDICTED: zinc finger protein ZPR1 homolog ... 58 1e-06 ref|XP_003529435.1| PREDICTED: zinc finger protein ZPR1 isoformX... 58 1e-06 gb|EXC24750.1| Zinc finger protein [Morus notabilis] 57 2e-06 ref|XP_006659490.1| PREDICTED: zinc finger protein ZPR1-like [Or... 57 2e-06 ref|XP_004293742.1| PREDICTED: zinc finger protein ZPR1-like [Fr... 57 2e-06 ref|XP_002305256.1| zinc finger family protein [Populus trichoca... 57 2e-06 gb|EMS54129.1| Zinc finger protein ZPR1 [Triticum urartu] 57 3e-06 ref|XP_004157758.1| PREDICTED: zinc finger protein ZPR1 homolog ... 57 3e-06 ref|XP_004145481.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger ... 57 3e-06 ref|NP_001062017.1| Os08g0471900 [Oryza sativa Japonica Group] g... 57 3e-06 gb|EEC83722.1| hypothetical protein OsI_29561 [Oryza sativa Indi... 57 3e-06 gb|ABR26166.1| zinc finger (zpr1-type) family protein [Oryza sat... 57 3e-06 gb|EOY04622.1| ZPR1 zinc-finger domain protein [Theobroma cacao] 57 3e-06 >ref|XP_002277047.1| PREDICTED: zinc finger protein ZPR1 homolog isoform 2 [Vitis vinifera] Length = 494 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 4 VPELDLELTSGTLGGIVTTVEGLITKICES 93 VPELDLEL SGTLGG+VTTVEGLITKICE+ Sbjct: 371 VPELDLELASGTLGGVVTTVEGLITKICEN 400 >ref|XP_002277005.1| PREDICTED: zinc finger protein ZPR1 homolog isoform 1 [Vitis vinifera] gi|297737977|emb|CBI27178.3| unnamed protein product [Vitis vinifera] Length = 489 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 4 VPELDLELTSGTLGGIVTTVEGLITKICES 93 VPELDLEL SGTLGG+VTTVEGLITKICE+ Sbjct: 366 VPELDLELASGTLGGVVTTVEGLITKICEN 395 >emb|CAN71442.1| hypothetical protein VITISV_043818 [Vitis vinifera] Length = 534 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 4 VPELDLELTSGTLGGIVTTVEGLITKICES 93 VPELDLEL SGTLGG+VTTVEGLITKICE+ Sbjct: 411 VPELDLELASGTLGGVVTTVEGLITKICEN 440 >ref|XP_006605520.1| PREDICTED: zinc finger protein ZPR1 homolog isoform X2 [Glycine max] Length = 401 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 KVPELDLEL SGTLGGIVTTVEGLITKI ES Sbjct: 270 KVPELDLELASGTLGGIVTTVEGLITKISES 300 >ref|XP_006583933.1| PREDICTED: zinc finger protein ZPR1 isoform X3 [Glycine max] Length = 474 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 KVPELDLEL SGTLGGIVTTVEGLITKI ES Sbjct: 366 KVPELDLELASGTLGGIVTTVEGLITKISES 396 >ref|XP_006583932.1| PREDICTED: zinc finger protein ZPR1 isoform X2 [Glycine max] Length = 479 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 KVPELDLEL SGTLGGIVTTVEGLITKI ES Sbjct: 366 KVPELDLELASGTLGGIVTTVEGLITKISES 396 >ref|XP_004981682.1| PREDICTED: zinc finger protein ZPR1-like [Setaria italica] Length = 498 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 KVPEL+LELTSGTLGG+VTTVEGLI KICE+ Sbjct: 370 KVPELELELTSGTLGGMVTTVEGLIVKICEA 400 >ref|XP_003556397.1| PREDICTED: zinc finger protein ZPR1 homolog isoformX1 [Glycine max] Length = 495 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 KVPELDLEL SGTLGGIVTTVEGLITKI ES Sbjct: 364 KVPELDLELASGTLGGIVTTVEGLITKISES 394 >ref|XP_003529435.1| PREDICTED: zinc finger protein ZPR1 isoformX1 [Glycine max] Length = 498 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 KVPELDLEL SGTLGGIVTTVEGLITKI ES Sbjct: 366 KVPELDLELASGTLGGIVTTVEGLITKISES 396 >gb|EXC24750.1| Zinc finger protein [Morus notabilis] Length = 538 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 K+PELDLEL SGTLGGIVTTVEGLITKI ES Sbjct: 402 KIPELDLELASGTLGGIVTTVEGLITKISES 432 >ref|XP_006659490.1| PREDICTED: zinc finger protein ZPR1-like [Oryza brachyantha] Length = 439 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/53 (60%), Positives = 35/53 (66%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICESKFYLAHPVTNTTFHIQLGHSTI 159 KVPEL+LEL SGTLGGIVTTVEGLI KICE+ QLG ST+ Sbjct: 308 KVPELELELASGTLGGIVTTVEGLIVKICEA--------LERVHGFQLGDSTL 352 >ref|XP_004293742.1| PREDICTED: zinc finger protein ZPR1-like [Fragaria vesca subsp. vesca] Length = 507 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 K+PEL+LEL SGTLGG+VTTVEGLITK+CES Sbjct: 370 KIPELELELGSGTLGGLVTTVEGLITKLCES 400 >ref|XP_002305256.1| zinc finger family protein [Populus trichocarpa] gi|222848220|gb|EEE85767.1| zinc finger family protein [Populus trichocarpa] Length = 506 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 KVPELDLEL SGTLGGIVTTVEGL+TKI ES Sbjct: 370 KVPELDLELASGTLGGIVTTVEGLVTKISES 400 >gb|EMS54129.1| Zinc finger protein ZPR1 [Triticum urartu] Length = 507 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 4 VPELDLELTSGTLGGIVTTVEGLITKICESKF 99 VPEL+LEL+SGTLGGIVTTVEGLI KICE F Sbjct: 351 VPELELELSSGTLGGIVTTVEGLIVKICEGMF 382 >ref|XP_004157758.1| PREDICTED: zinc finger protein ZPR1 homolog [Cucumis sativus] Length = 552 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 KVP+L+LELTSGTLGGIVTTVEGLITKI ES Sbjct: 428 KVPDLELELTSGTLGGIVTTVEGLITKISES 458 >ref|XP_004145481.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein ZPR1-like [Cucumis sativus] Length = 508 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 KVP+L+LELTSGTLGGIVTTVEGLITKI ES Sbjct: 367 KVPDLELELTSGTLGGIVTTVEGLITKISES 397 >ref|NP_001062017.1| Os08g0471900 [Oryza sativa Japonica Group] gi|42407366|dbj|BAD09355.1| putative zinc-finger protein [Oryza sativa Japonica Group] gi|42408647|dbj|BAD09868.1| putative zinc-finger protein [Oryza sativa Japonica Group] gi|113623986|dbj|BAF23931.1| Os08g0471900 [Oryza sativa Japonica Group] gi|215697436|dbj|BAG91430.1| unnamed protein product [Oryza sativa Japonica Group] gi|222640716|gb|EEE68848.1| hypothetical protein OsJ_27641 [Oryza sativa Japonica Group] gi|347737107|gb|AEP20527.1| zinc finger protein [Oryza sativa Japonica Group] Length = 501 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 KVPEL+LEL SGTLGGIVTTVEGLI KICE+ Sbjct: 373 KVPELELELASGTLGGIVTTVEGLIVKICEA 403 >gb|EEC83722.1| hypothetical protein OsI_29561 [Oryza sativa Indica Group] Length = 500 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 KVPEL+LEL SGTLGGIVTTVEGLI KICE+ Sbjct: 372 KVPELELELASGTLGGIVTTVEGLIVKICEA 402 >gb|ABR26166.1| zinc finger (zpr1-type) family protein [Oryza sativa Indica Group] Length = 252 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 KVPEL+LEL SGTLGGIVTTVEGLI KICE+ Sbjct: 124 KVPELELELASGTLGGIVTTVEGLIVKICEA 154 >gb|EOY04622.1| ZPR1 zinc-finger domain protein [Theobroma cacao] Length = 502 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 KVPELDLELTSGTLGGIVTTVEGLITKICES 93 +VPELDLEL SGTLGGIVTTVEGLITKI ES Sbjct: 366 RVPELDLELASGTLGGIVTTVEGLITKISES 396