BLASTX nr result
ID: Stemona21_contig00001373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00001373 (442 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271306.1| PREDICTED: ferredoxin-thioredoxin reductase,... 86 5e-15 gb|EXC04047.1| Ferredoxin-thioredoxin reductase, variable chain ... 86 7e-15 ref|XP_004298608.1| PREDICTED: lipoyl synthase, chloroplastic-li... 84 1e-14 ref|XP_003569953.1| PREDICTED: ferredoxin-thioredoxin reductase,... 84 1e-14 ref|XP_006448508.1| hypothetical protein CICLE_v10017019mg [Citr... 84 2e-14 ref|XP_006448507.1| hypothetical protein CICLE_v10017019mg [Citr... 84 2e-14 gb|EMJ27145.1| hypothetical protein PRUPE_ppa012324mg [Prunus pe... 84 2e-14 dbj|BAJ94431.1| predicted protein [Hordeum vulgare subsp. vulgar... 84 2e-14 gb|AFK46976.1| unknown [Lotus japonicus] 83 3e-14 ref|XP_004489188.1| PREDICTED: ferredoxin-thioredoxin reductase,... 83 4e-14 ref|XP_006394610.1| hypothetical protein EUTSA_v10005472mg [Eutr... 82 6e-14 ref|XP_006289924.1| hypothetical protein CARUB_v10003540mg [Caps... 82 6e-14 ref|XP_006288759.1| hypothetical protein CARUB_v10002077mg [Caps... 82 6e-14 ref|NP_197735.1| ferredoxin/thioredoxin reductase subunit A (var... 82 6e-14 gb|AEY80143.1| lipoic acid synthase [Jatropha curcas] 82 1e-13 ref|XP_006468671.1| PREDICTED: ferredoxin-thioredoxin reductase,... 81 1e-13 ref|XP_006648873.1| PREDICTED: ferredoxin-thioredoxin reductase,... 81 2e-13 ref|XP_006399333.1| hypothetical protein EUTSA_v10014787mg [Eutr... 81 2e-13 ref|XP_004953231.1| PREDICTED: ferredoxin-thioredoxin reductase,... 81 2e-13 gb|EOX98981.1| Ferredoxin/thioredoxin reductase subunit A 2 [The... 81 2e-13 >ref|XP_002271306.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain, chloroplastic [Vitis vinifera] gi|147820518|emb|CAN76575.1| hypothetical protein VITISV_024425 [Vitis vinifera] Length = 168 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+GARVRV PLKV+HVP++PEV+L GMEG +KQ+VGVWKGKRISAN P Sbjct: 88 KIGARVRVKVPLKVFHVPRVPEVDLTGMEGVLKQYVGVWKGKRISANLP 136 >gb|EXC04047.1| Ferredoxin-thioredoxin reductase, variable chain [Morus notabilis] Length = 171 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 ++GARVRV PLKVYHVPK+PE+++ GMEG +KQ+VGVWKGKRISAN P Sbjct: 94 RIGARVRVKVPLKVYHVPKVPEIDILGMEGELKQYVGVWKGKRISANLP 142 >ref|XP_004298608.1| PREDICTED: lipoyl synthase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 532 Score = 84.3 bits (207), Expect = 1e-14 Identities = 35/48 (72%), Positives = 44/48 (91%) Frame = -2 Query: 144 VGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 +GARV+VT PLKVYHVP++PEV++ GMEG +KQ+VG+WKGKRISAN P Sbjct: 456 IGARVKVTVPLKVYHVPRVPEVDITGMEGELKQYVGLWKGKRISANLP 503 >ref|XP_003569953.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Brachypodium distachyon] Length = 154 Score = 84.3 bits (207), Expect = 1e-14 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 KVG RVRVTAPL+VYHV K P+++++GMEG IKQ+VGVWKGKRI+ANFP Sbjct: 73 KVGKRVRVTAPLRVYHVVKAPDLDIQGMEGVIKQYVGVWKGKRITANFP 121 >ref|XP_006448508.1| hypothetical protein CICLE_v10017019mg [Citrus clementina] gi|557551119|gb|ESR61748.1| hypothetical protein CICLE_v10017019mg [Citrus clementina] Length = 160 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/49 (71%), Positives = 44/49 (89%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+GARV+V PLKVYHVP++PE++L GMEG +KQ+VGVWKGK+ISAN P Sbjct: 83 KIGARVKVKVPLKVYHVPRVPELDLSGMEGVLKQYVGVWKGKKISANLP 131 >ref|XP_006448507.1| hypothetical protein CICLE_v10017019mg [Citrus clementina] gi|557551118|gb|ESR61747.1| hypothetical protein CICLE_v10017019mg [Citrus clementina] Length = 154 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/49 (71%), Positives = 44/49 (89%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+GARV+V PLKVYHVP++PE++L GMEG +KQ+VGVWKGK+ISAN P Sbjct: 83 KIGARVKVKVPLKVYHVPRVPELDLSGMEGVLKQYVGVWKGKKISANLP 131 >gb|EMJ27145.1| hypothetical protein PRUPE_ppa012324mg [Prunus persica] Length = 174 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/49 (71%), Positives = 44/49 (89%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+GARV+V PLKVYHVP++PE+E+ GMEG +KQ+VG+WKGKRISAN P Sbjct: 97 KIGARVKVKVPLKVYHVPRVPELEITGMEGELKQYVGLWKGKRISANLP 145 >dbj|BAJ94431.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326521012|dbj|BAJ92869.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 148 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/49 (73%), Positives = 45/49 (91%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+G RVRVTAP++VYHVPK P+++LRGMEG +KQ+VGVWKGKRI+AN P Sbjct: 70 KLGKRVRVTAPVRVYHVPKAPDLDLRGMEGVVKQYVGVWKGKRITANRP 118 >gb|AFK46976.1| unknown [Lotus japonicus] Length = 166 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 KVGARVRV PLKVYHVPK+PE +L G EG IKQ+V +WKGK+ISANFP Sbjct: 89 KVGARVRVKVPLKVYHVPKVPEFDLEGAEGEIKQYVALWKGKKISANFP 137 >ref|XP_004489188.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Cicer arietinum] Length = 129 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+GAR+RV PLKVYHVPK+PE++L GMEG IKQ V +WKGKRISAN P Sbjct: 50 KIGARIRVKVPLKVYHVPKVPEIDLAGMEGNIKQNVALWKGKRISANLP 98 >ref|XP_006394610.1| hypothetical protein EUTSA_v10005472mg [Eutrema salsugineum] gi|557091249|gb|ESQ31896.1| hypothetical protein EUTSA_v10005472mg [Eutrema salsugineum] Length = 183 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 KVG+RVRVT PLKVYHV ++PEVEL GMEG +K +V VWKGKRISAN P Sbjct: 104 KVGSRVRVTVPLKVYHVNRVPEVELEGMEGKLKDYVAVWKGKRISANLP 152 >ref|XP_006289924.1| hypothetical protein CARUB_v10003540mg [Capsella rubella] gi|482558630|gb|EOA22822.1| hypothetical protein CARUB_v10003540mg [Capsella rubella] Length = 184 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+GARVRVTAPLKVYHV ++PEVEL GMEG IK +V +WKGKRISAN P Sbjct: 105 KIGARVRVTAPLKVYHVVRVPEVELMGMEGFIKDYVVLWKGKRISANLP 153 >ref|XP_006288759.1| hypothetical protein CARUB_v10002077mg [Capsella rubella] gi|482557465|gb|EOA21657.1| hypothetical protein CARUB_v10002077mg [Capsella rubella] Length = 180 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+G+RVRVTAPLKVYHV ++PEV+L GMEG +K +V VWKGKRISAN P Sbjct: 101 KIGSRVRVTAPLKVYHVNRVPEVDLEGMEGKLKDYVSVWKGKRISANLP 149 >ref|NP_197735.1| ferredoxin/thioredoxin reductase subunit A (variable subunit) 1 [Arabidopsis thaliana] gi|9759082|dbj|BAB09560.1| unnamed protein product [Arabidopsis thaliana] gi|45752724|gb|AAS76260.1| At5g23440 [Arabidopsis thaliana] gi|62320262|dbj|BAD94540.1| hypothetical protein [Arabidopsis thaliana] gi|332005785|gb|AED93168.1| ferredoxin/thioredoxin reductase subunit A (variable subunit) 1 [Arabidopsis thaliana] Length = 182 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+G+RVRVTAPLKVYHV ++PEV+L GMEG +K +V VWKGKRISAN P Sbjct: 103 KIGSRVRVTAPLKVYHVNRVPEVDLEGMEGKLKDYVAVWKGKRISANLP 151 >gb|AEY80143.1| lipoic acid synthase [Jatropha curcas] Length = 201 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+GARVRV PLKVYHVP++PEV+L G EG +KQ+V +WKGKRISAN P Sbjct: 123 KIGARVRVKVPLKVYHVPRVPEVDLTGKEGNLKQYVALWKGKRISANLP 171 >ref|XP_006468671.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain, chloroplastic-like [Citrus sinensis] Length = 160 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/49 (69%), Positives = 43/49 (87%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+GA+V+V PLKVYHVP++PE +L GMEG +KQ+VGVWKGK+ISAN P Sbjct: 83 KIGAKVKVKVPLKVYHVPRVPEHDLSGMEGVLKQYVGVWKGKKISANMP 131 >ref|XP_006648873.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Oryza brachyantha] Length = 135 Score = 80.9 bits (198), Expect = 2e-13 Identities = 34/49 (69%), Positives = 43/49 (87%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+G RVRVTAPL+VYHV K P++++ GMEG IKQ+V +WKGKRI+ANFP Sbjct: 55 KIGKRVRVTAPLRVYHVMKAPDLDIEGMEGVIKQYVAIWKGKRITANFP 103 >ref|XP_006399333.1| hypothetical protein EUTSA_v10014787mg [Eutrema salsugineum] gi|557100423|gb|ESQ40786.1| hypothetical protein EUTSA_v10014787mg [Eutrema salsugineum] Length = 183 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 K+GARVRVT PLKVYHV ++PEVEL GMEG IK +V +WKGKRISAN P Sbjct: 104 KIGARVRVTVPLKVYHVVRVPEVELMGMEGFIKDYVVLWKGKRISANLP 152 >ref|XP_004953231.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Setaria italica] Length = 153 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/71 (54%), Positives = 49/71 (69%) Frame = -2 Query: 213 QVALTTXXXXXXXXXXXXXXXSKVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGV 34 QVALT+ K+G RVRVT PL+VYHV K P+++++GMEG IKQ+V V Sbjct: 50 QVALTSEVSSDDVAAEEAAAAPKIGKRVRVTEPLRVYHVLKAPDLDIQGMEGVIKQYVCV 109 Query: 33 WKGKRISANFP 1 WKGKRI+ANFP Sbjct: 110 WKGKRITANFP 120 >gb|EOX98981.1| Ferredoxin/thioredoxin reductase subunit A 2 [Theobroma cacao] Length = 168 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -2 Query: 147 KVGARVRVTAPLKVYHVPKIPEVELRGMEGTIKQFVGVWKGKRISANFP 1 KVGA+VRV PLKVYHVP++ EV+L GMEG IKQ+V +WKGKRISAN P Sbjct: 90 KVGAKVRVKVPLKVYHVPRVQEVDLTGMEGVIKQYVALWKGKRISANLP 138