BLASTX nr result
ID: Stemona21_contig00000194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00000194 (369 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280220.1| PREDICTED: putative glucose-6-phosphate 1-ep... 59 9e-07 emb|CAN81195.1| hypothetical protein VITISV_022854 [Vitis vinifera] 59 9e-07 ref|XP_004306701.1| PREDICTED: putative glucose-6-phosphate 1-ep... 55 1e-05 >ref|XP_002280220.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Vitis vinifera] gi|297745389|emb|CBI40469.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 367 ITLKPGEEWTGRLELSIVPSSYCSDPLDH 281 ITLKPGEEWTGRLELS+VPSS+CS+ LDH Sbjct: 284 ITLKPGEEWTGRLELSVVPSSFCSEYLDH 312 >emb|CAN81195.1| hypothetical protein VITISV_022854 [Vitis vinifera] Length = 364 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 367 ITLKPGEEWTGRLELSIVPSSYCSDPLDH 281 ITLKPGEEWTGRLELS+VPSS+CS+ LDH Sbjct: 336 ITLKPGEEWTGRLELSVVPSSFCSEYLDH 364 >ref|XP_004306701.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Fragaria vesca subsp. vesca] Length = 317 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 367 ITLKPGEEWTGRLELSIVPSSYCSDPLDHLRG 272 +TLKPGEEWTGRL+LS+VPSS+CS+ LD +G Sbjct: 284 VTLKPGEEWTGRLQLSVVPSSFCSENLDLEKG 315