BLASTX nr result
ID: Sinomenium22_contig00020890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00020890 (976 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71692.1| hypothetical protein VITISV_015629 [Vitis vinifera] 46 6e-07 >emb|CAN71692.1| hypothetical protein VITISV_015629 [Vitis vinifera] Length = 372 Score = 45.8 bits (107), Expect(4) = 6e-07 Identities = 24/43 (55%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = -1 Query: 769 QEGRLVAFLSKMLLDAKKYY-TYD*ELYALV*VFK*WRHYLPH 644 QEG LVAF S+ L AKK Y TYD E YA+V + W+HYL + Sbjct: 261 QEGHLVAFFSEKLNGAKKKYSTYDLEFYAMVQAIRHWQHYLSY 303 Score = 25.0 bits (53), Expect(4) = 6e-07 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 839 LPNFEKVINDDCDKSH 792 LP+FEKV CD SH Sbjct: 237 LPDFEKVFEVACDASH 252 Score = 24.6 bits (52), Expect(4) = 6e-07 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 558 DHQALIYLYLQKKPSPKHEELS 493 DH+AL YL QKK + +H + S Sbjct: 311 DHEALQYLNSQKKLNSRHAKWS 332 Score = 23.5 bits (49), Expect(4) = 6e-07 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 975 FICSVCVVTGPIIKCLKHCSFAWT 904 FI + + PI KC+K F WT Sbjct: 192 FIQNFNSIMAPITKCMKPGLFIWT 215