BLASTX nr result
ID: Sinomenium22_contig00006100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00006100 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006367791.1| PREDICTED: E3 ubiquitin-protein ligase RNF4-... 87 2e-15 ref|XP_004240456.1| PREDICTED: uncharacterized protein LOC101256... 87 2e-15 ref|XP_004247066.1| PREDICTED: uncharacterized RING finger prote... 86 4e-15 ref|XP_007131671.1| hypothetical protein PHAVU_011G032000g [Phas... 85 1e-14 emb|CBI18799.3| unnamed protein product [Vitis vinifera] 84 2e-14 ref|XP_002262663.1| PREDICTED: uncharacterized protein LOC100246... 84 2e-14 emb|CAN78038.1| hypothetical protein VITISV_023397 [Vitis vinifera] 84 2e-14 ref|XP_004290190.1| PREDICTED: uncharacterized protein LOC101313... 84 2e-14 gb|EYU39207.1| hypothetical protein MIMGU_mgv1a014058mg [Mimulus... 84 3e-14 ref|XP_006443566.1| hypothetical protein CICLE_v10022263mg [Citr... 83 3e-14 gb|ACJ86065.1| unknown [Medicago truncatula] gi|388494518|gb|AFK... 83 5e-14 gb|ACJ83847.1| unknown [Medicago truncatula] 83 5e-14 ref|XP_007049716.1| RING/U-box superfamily protein, putative [Th... 82 8e-14 ref|XP_004505742.1| PREDICTED: LON peptidase N-terminal domain a... 82 8e-14 ref|XP_003537790.1| PREDICTED: E3 ubiquitin-protein ligase RNF4-... 82 1e-13 ref|NP_001237594.1| uncharacterized protein LOC100306616 [Glycin... 82 1e-13 ref|XP_002532746.1| RING finger protein, putative [Ricinus commu... 82 1e-13 ref|NP_187376.1| C3HC4 zinc finger domain-containing protein [Ar... 82 1e-13 ref|XP_007200506.1| hypothetical protein PRUPE_ppa012906mg [Prun... 81 2e-13 ref|XP_006407858.1| hypothetical protein EUTSA_v10021611mg [Eutr... 80 2e-13 >ref|XP_006367791.1| PREDICTED: E3 ubiquitin-protein ligase RNF4-like [Solanum tuberosum] Length = 215 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 EEMSTKCGHIFCK CIK +IAAQ KCPTCRRKL +KDT R+YLP+T+ Sbjct: 169 EEMSTKCGHIFCKACIKASIAAQGKCPTCRRKLAMKDTIRVYLPTTN 215 >ref|XP_004240456.1| PREDICTED: uncharacterized protein LOC101256594 [Solanum lycopersicum] Length = 215 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 EEMSTKCGHIFCK CIK +IAAQ KCPTCRRKL KDT R+YLP+T+ Sbjct: 169 EEMSTKCGHIFCKACIKASIAAQGKCPTCRRKLAAKDTIRVYLPATN 215 >ref|XP_004247066.1| PREDICTED: uncharacterized RING finger protein C548.05c-like [Solanum lycopersicum] Length = 225 Score = 86.3 bits (212), Expect = 4e-15 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPS 137 EEMSTKCGHIFCK CIK +IAAQ KCPTCRRK+T+KDT R+YLP+ Sbjct: 179 EEMSTKCGHIFCKACIKASIAAQGKCPTCRRKITMKDTIRVYLPA 223 >ref|XP_007131671.1| hypothetical protein PHAVU_011G032000g [Phaseolus vulgaris] gi|593127245|ref|XP_007131672.1| hypothetical protein PHAVU_011G032000g [Phaseolus vulgaris] gi|561004671|gb|ESW03665.1| hypothetical protein PHAVU_011G032000g [Phaseolus vulgaris] gi|561004672|gb|ESW03666.1| hypothetical protein PHAVU_011G032000g [Phaseolus vulgaris] Length = 206 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 EEMST+CGHIFCK CIK AI+AQ KCPTCR+K+TVK+ R++LPSTS Sbjct: 160 EEMSTRCGHIFCKNCIKAAISAQGKCPTCRKKITVKELIRVFLPSTS 206 >emb|CBI18799.3| unnamed protein product [Vitis vinifera] Length = 163 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 +EMSTKCGHIFCK CIK AI+AQ KCPTCR+++T+KDT RIYLP+ S Sbjct: 117 DEMSTKCGHIFCKMCIKAAISAQGKCPTCRKRVTMKDTIRIYLPAAS 163 >ref|XP_002262663.1| PREDICTED: uncharacterized protein LOC100246586 [Vitis vinifera] Length = 209 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 +EMSTKCGHIFCK CIK AI+AQ KCPTCR+++T+KDT RIYLP+ S Sbjct: 163 DEMSTKCGHIFCKMCIKAAISAQGKCPTCRKRVTMKDTIRIYLPAAS 209 >emb|CAN78038.1| hypothetical protein VITISV_023397 [Vitis vinifera] Length = 52 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 +EMSTKCGHIFCK CIK AI+AQ KCPTCR+++T+KDT RIYLP+ S Sbjct: 6 DEMSTKCGHIFCKMCIKAAISAQGKCPTCRKRVTMKDTIRIYLPAAS 52 >ref|XP_004290190.1| PREDICTED: uncharacterized protein LOC101313661 [Fragaria vesca subsp. vesca] Length = 212 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 EEMSTKCGHIFCKKCIK AI AQ KCPTCRRK+T K+ R++LP++S Sbjct: 166 EEMSTKCGHIFCKKCIKAAITAQGKCPTCRRKVTAKELIRVFLPTSS 212 >gb|EYU39207.1| hypothetical protein MIMGU_mgv1a014058mg [Mimulus guttatus] gi|604335266|gb|EYU39208.1| hypothetical protein MIMGU_mgv1a014058mg [Mimulus guttatus] Length = 202 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLP 134 EE STKCGHIFCK CIK AIAAQSKCPTCRRK TVKD R+YLP Sbjct: 156 EETSTKCGHIFCKGCIKAAIAAQSKCPTCRRKTTVKDLIRVYLP 199 >ref|XP_006443566.1| hypothetical protein CICLE_v10022263mg [Citrus clementina] gi|567902158|ref|XP_006443567.1| hypothetical protein CICLE_v10022263mg [Citrus clementina] gi|567902160|ref|XP_006443568.1| hypothetical protein CICLE_v10022263mg [Citrus clementina] gi|567902162|ref|XP_006443569.1| hypothetical protein CICLE_v10022263mg [Citrus clementina] gi|567902164|ref|XP_006443570.1| hypothetical protein CICLE_v10022263mg [Citrus clementina] gi|568851131|ref|XP_006479247.1| PREDICTED: E3 ubiquitin-protein ligase RNF4-like isoform X1 [Citrus sinensis] gi|568851133|ref|XP_006479248.1| PREDICTED: E3 ubiquitin-protein ligase RNF4-like isoform X2 [Citrus sinensis] gi|568851135|ref|XP_006479249.1| PREDICTED: E3 ubiquitin-protein ligase RNF4-like isoform X3 [Citrus sinensis] gi|568851137|ref|XP_006479250.1| PREDICTED: E3 ubiquitin-protein ligase RNF4-like isoform X4 [Citrus sinensis] gi|557545828|gb|ESR56806.1| hypothetical protein CICLE_v10022263mg [Citrus clementina] gi|557545829|gb|ESR56807.1| hypothetical protein CICLE_v10022263mg [Citrus clementina] gi|557545830|gb|ESR56808.1| hypothetical protein CICLE_v10022263mg [Citrus clementina] gi|557545831|gb|ESR56809.1| hypothetical protein CICLE_v10022263mg [Citrus clementina] gi|557545832|gb|ESR56810.1| hypothetical protein CICLE_v10022263mg [Citrus clementina] Length = 208 Score = 83.2 bits (204), Expect = 3e-14 Identities = 34/47 (72%), Positives = 43/47 (91%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 EEMSTKCGHIFCK CIK+AIA Q+KCPTCR+K+TV++ R++LP+TS Sbjct: 162 EEMSTKCGHIFCKACIKSAIATQNKCPTCRKKVTVRELIRVFLPATS 208 >gb|ACJ86065.1| unknown [Medicago truncatula] gi|388494518|gb|AFK35325.1| unknown [Medicago truncatula] Length = 242 Score = 82.8 bits (203), Expect = 5e-14 Identities = 33/47 (70%), Positives = 43/47 (91%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 EEMST+CGHIFCK CIK AI+AQ+KCPTCR+K+TVK+ R++LP+T+ Sbjct: 196 EEMSTRCGHIFCKSCIKAAISAQAKCPTCRKKITVKELIRVFLPTTA 242 >gb|ACJ83847.1| unknown [Medicago truncatula] Length = 247 Score = 82.8 bits (203), Expect = 5e-14 Identities = 33/47 (70%), Positives = 43/47 (91%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 EEMST+CGHIFCK CIK AI+AQ+KCPTCR+K+TVK+ R++LP+T+ Sbjct: 201 EEMSTRCGHIFCKSCIKAAISAQAKCPTCRKKITVKELIRVFLPTTA 247 >ref|XP_007049716.1| RING/U-box superfamily protein, putative [Theobroma cacao] gi|508701977|gb|EOX93873.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 208 Score = 82.0 bits (201), Expect = 8e-14 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 EEMST+CGHIFCK CIK AIAAQ KCPTCR+++TVK+ R++LPS S Sbjct: 162 EEMSTRCGHIFCKACIKAAIAAQGKCPTCRKRVTVKELIRVFLPSAS 208 >ref|XP_004505742.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 3-like isoform X1 [Cicer arietinum] gi|502144767|ref|XP_004505743.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 3-like isoform X2 [Cicer arietinum] Length = 220 Score = 82.0 bits (201), Expect = 8e-14 Identities = 33/46 (71%), Positives = 42/46 (91%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPST 140 EEMST+CGHIFCK CIK AI+AQ+KCPTCR+K+TVK+ R++LP+T Sbjct: 174 EEMSTRCGHIFCKTCIKAAISAQAKCPTCRKKITVKELIRVFLPTT 219 >ref|XP_003537790.1| PREDICTED: E3 ubiquitin-protein ligase RNF4-like [Glycine max] Length = 205 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +3 Query: 6 EMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 EMST+CGHIFCK CIK AI+AQ KCPTCR+K+ KD R+YLPSTS Sbjct: 160 EMSTRCGHIFCKDCIKAAISAQGKCPTCRKKVVAKDLIRVYLPSTS 205 >ref|NP_001237594.1| uncharacterized protein LOC100306616 [Glycine max] gi|255629089|gb|ACU14889.1| unknown [Glycine max] Length = 205 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +3 Query: 6 EMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 EMST+CGHIFCK CIK AI+AQ KCPTCR+K+ KD R+YLPSTS Sbjct: 160 EMSTRCGHIFCKDCIKAAISAQGKCPTCRKKVVAKDLIRVYLPSTS 205 >ref|XP_002532746.1| RING finger protein, putative [Ricinus communis] gi|223527523|gb|EEF29648.1| RING finger protein, putative [Ricinus communis] Length = 224 Score = 81.6 bits (200), Expect = 1e-13 Identities = 33/47 (70%), Positives = 41/47 (87%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 EE STKCGHIFCK CIKTAI QSKCPTCR+++T+K+ R++LP+TS Sbjct: 176 EETSTKCGHIFCKACIKTAIGVQSKCPTCRKRVTIKELIRVFLPATS 222 >ref|NP_187376.1| C3HC4 zinc finger domain-containing protein [Arabidopsis thaliana] gi|145331994|ref|NP_001078119.1| C3HC4 zinc finger domain-containing protein [Arabidopsis thaliana] gi|6642645|gb|AAF20226.1|AC012395_13 putative RING zinc finger protein [Arabidopsis thaliana] gi|332640992|gb|AEE74513.1| C3HC4 zinc finger domain-containing protein [Arabidopsis thaliana] gi|332640993|gb|AEE74514.1| C3HC4 zinc finger domain-containing protein [Arabidopsis thaliana] Length = 182 Score = 81.6 bits (200), Expect = 1e-13 Identities = 32/46 (69%), Positives = 42/46 (91%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPST 140 +E+STKCGHIFCKKCIK A++ Q+KCPTCR+K+TVKD R++LP+T Sbjct: 136 QEVSTKCGHIFCKKCIKNALSLQAKCPTCRKKITVKDLIRVFLPTT 181 >ref|XP_007200506.1| hypothetical protein PRUPE_ppa012906mg [Prunus persica] gi|462395906|gb|EMJ01705.1| hypothetical protein PRUPE_ppa012906mg [Prunus persica] Length = 150 Score = 80.9 bits (198), Expect = 2e-13 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPST 140 EEMSTKCGHIFCK CI+ AI AQ KCPTCRRK+T+K+ R++LP+T Sbjct: 104 EEMSTKCGHIFCKACIRAAIGAQGKCPTCRRKVTMKELIRVFLPTT 149 >ref|XP_006407858.1| hypothetical protein EUTSA_v10021611mg [Eutrema salsugineum] gi|557109004|gb|ESQ49311.1| hypothetical protein EUTSA_v10021611mg [Eutrema salsugineum] Length = 183 Score = 80.5 bits (197), Expect = 2e-13 Identities = 32/47 (68%), Positives = 41/47 (87%) Frame = +3 Query: 3 EEMSTKCGHIFCKKCIKTAIAAQSKCPTCRRKLTVKDTFRIYLPSTS 143 EEMSTKCGHIFC KCI+ AI+ Q+KCPTCR+K+T K+ R++LP+TS Sbjct: 137 EEMSTKCGHIFCNKCIRNAISCQAKCPTCRKKVTAKELIRVFLPTTS 183