BLASTX nr result
ID: Sinomenium21_contig00050446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00050446 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75478.1| hypothetical protein VITISV_020209 [Vitis vinifera] 55 8e-06 >emb|CAN75478.1| hypothetical protein VITISV_020209 [Vitis vinifera] Length = 1074 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/68 (39%), Positives = 40/68 (58%) Frame = +3 Query: 9 HHAYLCLDPNSDKFFTSRHVRFVEHIFPFRSYNPSNQSTPSPPITDWLSVPNISPVLTST 188 H YLCL+P +++ + SRHV F E FPF++ +P +Q + P+T +P SP+L Sbjct: 409 HKGYLCLNPTTNRVYISRHVVFAETTFPFQALSPPSQQSYHIPVTPAFPLPP-SPILFPP 467 Query: 189 AKSQPLHT 212 S PL T Sbjct: 468 TTSSPLAT 475