BLASTX nr result
ID: Scutellaria24_contig00033591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00033591 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI34397.1| hypothetical protein STB1_57t00025 [Solanum tuber... 60 2e-07 >gb|ABI34397.1| hypothetical protein STB1_57t00025 [Solanum tuberosum] Length = 168 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/63 (44%), Positives = 35/63 (55%) Frame = -2 Query: 326 KIFHGGVMRYEPAMVYQGGRVDYFDYVDGEMFGLLELKEFTDELGYAGKNIRFWHQFGHS 147 KI HGGVM+ P Y G +DY DYV+G L E K+ + GY +I FWH+ G S Sbjct: 27 KIHHGGVMKRTPEKHYVEGNIDYIDYVNGNKLDLDEFKKMAEICGYLKNSITFWHKCGSS 86 Query: 146 LER 138 R Sbjct: 87 SNR 89