BLASTX nr result
ID: Scutellaria23_contig00001963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00001963 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269049.2| PREDICTED: putative disease resistance RPP13... 55 8e-06 >ref|XP_002269049.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Length = 1427 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/72 (41%), Positives = 44/72 (61%) Frame = +1 Query: 10 VHLRSKYSYHQTCSSSITLQVSTSNTIMNYNRLKILKLIGSDMVELPSAIGQLKHLRYFD 189 +H+ Y +T +I+ QV N IM L++L L+G M E+PS+IG+L HLRY + Sbjct: 535 IHVSLVPQYSRTLFGNISNQV-LHNLIMPMRYLRVLSLVGCGMGEVPSSIGELIHLRYLN 593 Query: 190 LSNSKIHSLPRT 225 S S+I SLP + Sbjct: 594 FSYSRIRSLPNS 605