BLASTX nr result
ID: Scutellaria23_contig00001916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00001916 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q6VMW0.1|Q8OMT_MENPI RecName: Full=8-hydroxyquercetin 8-O-met... 55 6e-06 >sp|Q6VMW0.1|Q8OMT_MENPI RecName: Full=8-hydroxyquercetin 8-O-methyltransferase; AltName: Full=Flavonol 8-O-methyltransferase gi|38047395|gb|AAR09600.1| flavonoid 8-O-methyltransferase [Mentha x piperita] Length = 366 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 2 EWAKLFFDAGFGNYKISHVLGSRSVIEVFP 91 EW KLFFDAGF NYKI+ VLG RSVIEVFP Sbjct: 337 EWGKLFFDAGFTNYKITRVLGLRSVIEVFP 366