BLASTX nr result
ID: Scutellaria23_contig00001403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00001403 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269747.2| PREDICTED: probable methyltransferase PMT15-... 55 6e-06 >ref|XP_002269747.2| PREDICTED: probable methyltransferase PMT15-like [Vitis vinifera] gi|296089068|emb|CBI38771.3| unnamed protein product [Vitis vinifera] Length = 632 Score = 55.1 bits (131), Expect = 6e-06 Identities = 20/39 (51%), Positives = 30/39 (76%) Frame = +1 Query: 130 WGGVTHYLSSRTKKTNLYYMAITTILCSLFYLIGIWQHS 246 W ++YL+S+ K+ NLYY+A + LCS+FY+ GIWQH+ Sbjct: 3 WPNPSYYLASKAKRPNLYYLATSVTLCSIFYIAGIWQHT 41