BLASTX nr result
ID: Scutellaria22_contig00038074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00038074 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA53149.1| TPA: hypothetical protein ZEAMMB73_943468 [Zea m... 58 9e-07 ref|XP_003564339.1| PREDICTED: uncharacterized protein LOC100843... 57 2e-06 ref|XP_002516585.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >tpg|DAA53149.1| TPA: hypothetical protein ZEAMMB73_943468 [Zea mays] Length = 160 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -1 Query: 212 QKTYDSESYLQNFDEGSGTIEEPDNLYRSFSARYANPSRFHRR 84 ++ YD+ SY QNFD+G +EEPDNL RSFSAR+A PSR +R Sbjct: 115 REPYDAYSYAQNFDDGEAWVEEPDNLSRSFSARFAVPSRVFQR 157 >ref|XP_003564339.1| PREDICTED: uncharacterized protein LOC100843244 [Brachypodium distachyon] Length = 149 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -1 Query: 218 AMQKTYDSESYLQNFDEGSGTIEEPDNLYRSFSARYANPSRFHRR 84 A ++ YD+ SY QNFD+G+ +EEP+NL RSFSAR+A PSR +R Sbjct: 102 AAREPYDAYSYAQNFDDGAAWVEEPENLSRSFSARFAVPSRVLQR 146 >ref|XP_002516585.1| conserved hypothetical protein [Ricinus communis] gi|223544405|gb|EEF45926.1| conserved hypothetical protein [Ricinus communis] Length = 118 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/67 (44%), Positives = 37/67 (55%), Gaps = 2/67 (2%) Frame = -1 Query: 293 SNQKWA--TFWRXXXXXXXXXXXXSAFAMQKTYDSESYLQNFDEGSGTIEEPDNLYRSFS 120 +N KWA WR +Q +YD + Y QNFD G+G E PDNL RSFS Sbjct: 37 NNNKWAWHRLWRRISREKKKIFSSVPVTLQASYDPQEYHQNFDHGTGWTE-PDNLSRSFS 95 Query: 119 ARYANPS 99 AR+A+PS Sbjct: 96 ARFADPS 102