BLASTX nr result
ID: Scutellaria22_contig00038040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00038040 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534278.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_002534278.1| conserved hypothetical protein [Ricinus communis] gi|223525587|gb|EEF28103.1| conserved hypothetical protein [Ricinus communis] Length = 122 Score = 59.3 bits (142), Expect = 3e-07 Identities = 23/56 (41%), Positives = 41/56 (73%) Frame = -2 Query: 288 TTLKSKNQNLHEKRKTNEGYGVRIFTNTGNVYARMPGEKSARYISGSKAAAEIARN 121 T ++ K++ L E+R+ N+G+ +RIF+ TG++Y+RMP E A+++SG+ A + RN Sbjct: 64 TRIEIKSRMLKERRQANQGFSIRIFSGTGHIYSRMPRESRAKFVSGASTIAVVGRN 119