BLASTX nr result
ID: Scutellaria22_contig00037862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037862 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD18955.1| reverse transcriptase [Orobanche crenata] 122 2e-26 gb|ABD18977.1| reverse transcriptase [Orobanche owerinii] 122 2e-26 gb|ABD19010.1| reverse transcriptase [Orobanche cernua var. dese... 121 5e-26 gb|ABD18997.1| reverse transcriptase [Orobanche cernua var. cumana] 121 5e-26 gb|ABD18986.1| reverse transcriptase [Orobanche cernua var. cern... 121 5e-26 >gb|ABD18955.1| reverse transcriptase [Orobanche crenata] Length = 87 Score = 122 bits (307), Expect = 2e-26 Identities = 57/72 (79%), Positives = 61/72 (84%) Frame = +1 Query: 4 QPDGFVNSSKPNHVCLLNKSLYGLKQSPRQWNRKFDECMQSLKFIRSAYDHCLYFKRDNF 183 QP GFV+ PNHVCLL KSLYGLKQSPRQWN+KFDECM SLKF RS YDHCLY+K D+ Sbjct: 16 QPVGFVDPKHPNHVCLLKKSLYGLKQSPRQWNKKFDECMLSLKFDRSNYDHCLYYKIDSE 75 Query: 184 VPVFLLIYVDDM 219 PVFLLIYVDDM Sbjct: 76 NPVFLLIYVDDM 87 >gb|ABD18977.1| reverse transcriptase [Orobanche owerinii] Length = 87 Score = 122 bits (307), Expect = 2e-26 Identities = 57/72 (79%), Positives = 61/72 (84%) Frame = +1 Query: 4 QPDGFVNSSKPNHVCLLNKSLYGLKQSPRQWNRKFDECMQSLKFIRSAYDHCLYFKRDNF 183 QP GFV+ PNHVCLL KSLYGLKQSPRQWN+KFDECM SLKF RS YDHCLY+K D+ Sbjct: 16 QPVGFVDRKHPNHVCLLKKSLYGLKQSPRQWNKKFDECMLSLKFERSNYDHCLYYKIDSE 75 Query: 184 VPVFLLIYVDDM 219 PVFLLIYVDDM Sbjct: 76 NPVFLLIYVDDM 87 >gb|ABD19010.1| reverse transcriptase [Orobanche cernua var. desertorum] Length = 87 Score = 121 bits (304), Expect = 5e-26 Identities = 56/72 (77%), Positives = 61/72 (84%) Frame = +1 Query: 4 QPDGFVNSSKPNHVCLLNKSLYGLKQSPRQWNRKFDECMQSLKFIRSAYDHCLYFKRDNF 183 QP GFV+ PNHVCLL KSLYGLKQSPRQWN+KFDE M SLKF+RS YDHCLY+K D+ Sbjct: 16 QPIGFVDPKHPNHVCLLKKSLYGLKQSPRQWNKKFDEYMLSLKFVRSNYDHCLYYKTDSK 75 Query: 184 VPVFLLIYVDDM 219 PVFLLIYVDDM Sbjct: 76 NPVFLLIYVDDM 87 >gb|ABD18997.1| reverse transcriptase [Orobanche cernua var. cumana] Length = 87 Score = 121 bits (304), Expect = 5e-26 Identities = 56/72 (77%), Positives = 61/72 (84%) Frame = +1 Query: 4 QPDGFVNSSKPNHVCLLNKSLYGLKQSPRQWNRKFDECMQSLKFIRSAYDHCLYFKRDNF 183 QP GFV+ PNHVCLL KSLYGLKQSPRQWN+KFDE M SLKF+RS YDHCLY+K D+ Sbjct: 16 QPIGFVDPKHPNHVCLLEKSLYGLKQSPRQWNKKFDEYMLSLKFVRSNYDHCLYYKTDSK 75 Query: 184 VPVFLLIYVDDM 219 PVFLLIYVDDM Sbjct: 76 NPVFLLIYVDDM 87 >gb|ABD18986.1| reverse transcriptase [Orobanche cernua var. cernua] gi|87083150|gb|ABD19027.1| reverse transcriptase [Orobanche cernua var. australiana] Length = 87 Score = 121 bits (304), Expect = 5e-26 Identities = 56/72 (77%), Positives = 61/72 (84%) Frame = +1 Query: 4 QPDGFVNSSKPNHVCLLNKSLYGLKQSPRQWNRKFDECMQSLKFIRSAYDHCLYFKRDNF 183 QP GFV+ PNHVCLL KSLYGLKQSPRQWN+KFDE M SLKF+RS YDHCLY+K D+ Sbjct: 16 QPIGFVDPKHPNHVCLLKKSLYGLKQSPRQWNKKFDEYMLSLKFVRSNYDHCLYYKTDSK 75 Query: 184 VPVFLLIYVDDM 219 PVFLLIYVDDM Sbjct: 76 NPVFLLIYVDDM 87