BLASTX nr result
ID: Scutellaria22_contig00037233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037233 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525190.1| Floral homeotic protein APETALA2, putative [... 88 8e-16 ref|XP_002326164.1| AP2 domain-containing transcription factor [... 81 8e-14 ref|XP_003539105.1| PREDICTED: ethylene-responsive transcription... 80 2e-13 ref|XP_003625570.1| Transcription factor [Medicago truncatula] g... 79 3e-13 ref|XP_002322849.1| AP2 domain-containing transcription factor [... 79 4e-13 >ref|XP_002525190.1| Floral homeotic protein APETALA2, putative [Ricinus communis] gi|223535487|gb|EEF37156.1| Floral homeotic protein APETALA2, putative [Ricinus communis] Length = 467 Score = 87.8 bits (216), Expect = 8e-16 Identities = 47/70 (67%), Positives = 50/70 (71%) Frame = -1 Query: 253 EAARAYDKAAIKCNGREAVTNFEQVTYEEELSSEAYIGAGEHHGLDLNLGIAPPDRPDCQ 74 EAARAYDKAAIKCNGREAVTNFE TYE E+ SE A + LDLNLGIAPPD Q Sbjct: 260 EAARAYDKAAIKCNGREAVTNFEPSTYEGEIMSEVN-NADGNQNLDLNLGIAPPDTSGTQ 318 Query: 73 IQNMETESFP 44 N+ET FP Sbjct: 319 KINIETSGFP 328 >ref|XP_002326164.1| AP2 domain-containing transcription factor [Populus trichocarpa] gi|222833357|gb|EEE71834.1| AP2 domain-containing transcription factor [Populus trichocarpa] Length = 496 Score = 81.3 bits (199), Expect = 8e-14 Identities = 43/58 (74%), Positives = 45/58 (77%) Frame = -1 Query: 253 EAARAYDKAAIKCNGREAVTNFEQVTYEEELSSEAYIGAGEHHGLDLNLGIAPPDRPD 80 EAARAYDKAAIKCNGREAVTNFE TYE E+ SE G G + LDLNLGIAPPD D Sbjct: 290 EAARAYDKAAIKCNGREAVTNFEPSTYEGEILSEPNNGDG-NQNLDLNLGIAPPDTSD 346 >ref|XP_003539105.1| PREDICTED: ethylene-responsive transcription factor RAP2-7-like [Glycine max] Length = 477 Score = 80.1 bits (196), Expect = 2e-13 Identities = 45/70 (64%), Positives = 47/70 (67%) Frame = -1 Query: 253 EAARAYDKAAIKCNGREAVTNFEQVTYEEELSSEAYIGAGEHHGLDLNLGIAPPDRPDCQ 74 EAARAYDKAAIKCNGREAVTNFE TYE EL S A I G LDLNLGIA P P Sbjct: 288 EAARAYDKAAIKCNGREAVTNFEPSTYEGELKSAA-INEGGSQNLDLNLGIATPGPPKEN 346 Query: 73 IQNMETESFP 44 ++ SFP Sbjct: 347 WGQLQFPSFP 356 >ref|XP_003625570.1| Transcription factor [Medicago truncatula] gi|355500585|gb|AES81788.1| Transcription factor [Medicago truncatula] Length = 471 Score = 79.3 bits (194), Expect = 3e-13 Identities = 42/64 (65%), Positives = 47/64 (73%) Frame = -1 Query: 253 EAARAYDKAAIKCNGREAVTNFEQVTYEEELSSEAYIGAGEHHGLDLNLGIAPPDRPDCQ 74 +AARAYDKAAIKCNGREAVTNFE +YE EL+S+A LDLNLGIAPP D Q Sbjct: 266 DAARAYDKAAIKCNGREAVTNFEASSYEGELTSQA-DNDDIKQNLDLNLGIAPPSNSDVQ 324 Query: 73 IQNM 62 + NM Sbjct: 325 MMNM 328 >ref|XP_002322849.1| AP2 domain-containing transcription factor [Populus trichocarpa] gi|222867479|gb|EEF04610.1| AP2 domain-containing transcription factor [Populus trichocarpa] Length = 461 Score = 79.0 bits (193), Expect = 4e-13 Identities = 44/72 (61%), Positives = 46/72 (63%) Frame = -1 Query: 253 EAARAYDKAAIKCNGREAVTNFEQVTYEEELSSEAYIGAGEHHGLDLNLGIAPPDRPDCQ 74 EAARAYDKAAIKCNGREAVTNFE YE E+ SE G G + LDL LGIAPPD D Sbjct: 253 EAARAYDKAAIKCNGREAVTNFEPSKYEGEILSEPSSGDG-NQNLDLKLGIAPPDASDSL 311 Query: 73 IQNMETESFPIH 38 N F H Sbjct: 312 KVNSNMGGFYFH 323