BLASTX nr result
ID: Scutellaria22_contig00036643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00036643 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515207.1| nucleotide binding protein, putative [Ricinu... 113 2e-23 ref|XP_002301542.1| predicted protein [Populus trichocarpa] gi|2... 111 5e-23 ref|XP_004163977.1| PREDICTED: WD repeat-containing protein 6-li... 107 1e-21 ref|XP_004148596.1| PREDICTED: uncharacterized protein LOC101207... 105 4e-21 ref|XP_002273071.2| PREDICTED: uncharacterized protein LOC100257... 101 7e-20 >ref|XP_002515207.1| nucleotide binding protein, putative [Ricinus communis] gi|223545687|gb|EEF47191.1| nucleotide binding protein, putative [Ricinus communis] Length = 1385 Score = 113 bits (282), Expect = 2e-23 Identities = 55/91 (60%), Positives = 71/91 (78%), Gaps = 3/91 (3%) Frame = +2 Query: 50 QWQLRRGQYLGEISALCFLHLPEHFSSLPLLLAGTGSQILVYDLGGGKVIKSFQVFEGIR 229 +W+L GQYLGEISALCFLHLP HFSSLP LLAGTGSQ+L+Y+L +I+SFQVF+GIR Sbjct: 10 KWRLHSGQYLGEISALCFLHLPSHFSSLPYLLAGTGSQLLLYNLEEVNIIESFQVFQGIR 69 Query: 230 VHGI---SLENYHEQLAGSALAFRVCVYGER 313 VHGI S++N + + LA +V ++GE+ Sbjct: 70 VHGITCESIDNSKGSSSSTLLASKVAIFGEK 100 >ref|XP_002301542.1| predicted protein [Populus trichocarpa] gi|222843268|gb|EEE80815.1| predicted protein [Populus trichocarpa] Length = 1455 Score = 111 bits (278), Expect = 5e-23 Identities = 52/91 (57%), Positives = 70/91 (76%), Gaps = 3/91 (3%) Frame = +2 Query: 50 QWQLRRGQYLGEISALCFLHLPEHFSSLPLLLAGTGSQILVYDLGGGKVIKSFQVFEGIR 229 +W+L RG YLGEISALCFLH P + SSLP LLAGTGSQ+L+Y+L GK+IKSF+VF+GIR Sbjct: 10 RWKLERGHYLGEISALCFLHPPSNLSSLPFLLAGTGSQLLLYNLESGKIIKSFEVFDGIR 69 Query: 230 VHGISLENYHEQ---LAGSALAFRVCVYGER 313 VHGI+ + E+ ++F++ V+GE+ Sbjct: 70 VHGITCSSSEEESSNFPSLTVSFKIAVFGEK 100 >ref|XP_004163977.1| PREDICTED: WD repeat-containing protein 6-like [Cucumis sativus] Length = 1079 Score = 107 bits (266), Expect = 1e-21 Identities = 52/89 (58%), Positives = 69/89 (77%), Gaps = 2/89 (2%) Frame = +2 Query: 53 WQLRRGQYLGEISALCFLHLPEHFSSLPLLLAGTGSQILVYDLGGGKVIKSFQVFEGIRV 232 W L GQYLGEISALCFLHLP SS P+LLAG+GS+++VY+L GK+++SF+VFEGIRV Sbjct: 10 WHLHSGQYLGEISALCFLHLPPQISSFPILLAGSGSEVMVYNLESGKMLESFRVFEGIRV 69 Query: 233 HGIS--LENYHEQLAGSALAFRVCVYGER 313 HGIS N++E + + L F + V+GE+ Sbjct: 70 HGISSISLNFNEASSFTKLDFILVVFGEK 98 >ref|XP_004148596.1| PREDICTED: uncharacterized protein LOC101207681 [Cucumis sativus] Length = 1371 Score = 105 bits (262), Expect = 4e-21 Identities = 51/89 (57%), Positives = 68/89 (76%), Gaps = 2/89 (2%) Frame = +2 Query: 53 WQLRRGQYLGEISALCFLHLPEHFSSLPLLLAGTGSQILVYDLGGGKVIKSFQVFEGIRV 232 W L GQYLGEISALCFLHLP SS P+LLAG+GS+++ Y+L GK+++SF+VFEGIRV Sbjct: 10 WHLHSGQYLGEISALCFLHLPPQISSFPILLAGSGSEVMAYNLESGKMLESFRVFEGIRV 69 Query: 233 HGIS--LENYHEQLAGSALAFRVCVYGER 313 HGIS N++E + + L F + V+GE+ Sbjct: 70 HGISSISLNFNEASSFTKLDFILVVFGEK 98 >ref|XP_002273071.2| PREDICTED: uncharacterized protein LOC100257191 [Vitis vinifera] Length = 1404 Score = 101 bits (251), Expect = 7e-20 Identities = 51/90 (56%), Positives = 65/90 (72%), Gaps = 2/90 (2%) Frame = +2 Query: 50 QWQLRRGQYLGEISALCFLHLPE--HFSSLPLLLAGTGSQILVYDLGGGKVIKSFQVFEG 223 +W+L G YLGEISALC +H P HFSSLP LLAGTGSQ+L+YDL K+++SF V EG Sbjct: 6 EWRLHGGHYLGEISALCLIHAPPLPHFSSLPYLLAGTGSQVLLYDLESVKILRSFHVLEG 65 Query: 224 IRVHGISLENYHEQLAGSALAFRVCVYGER 313 IRVHGI+ + GS L+ ++ V+GER Sbjct: 66 IRVHGIAC-RLVDCKEGSVLSVKIAVFGER 94