BLASTX nr result
ID: Scutellaria22_contig00036603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00036603 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32766.3| unnamed protein product [Vitis vinifera] 88 8e-16 ref|XP_002276858.1| PREDICTED: UDP-glycosyltransferase 86A1 [Vit... 88 8e-16 ref|XP_002879636.1| UDP-glucoronosyl/UDP-glucosyl transferase fa... 84 9e-15 ref|NP_181234.1| UDP-glycosyltransferase-like protein [Arabidops... 84 9e-15 gb|AFJ53011.1| UDP-glycosyltransferase 1 [Linum usitatissimum] 79 4e-13 >emb|CBI32766.3| unnamed protein product [Vitis vinifera] Length = 456 Score = 87.8 bits (216), Expect = 8e-16 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = +1 Query: 85 HAVMIPYPYQGHINPFVSLAVKLASHGFTITFVNTQSVHRRISRARTAPKCADIFSGARD 264 HA++IPYP QGH+ PFV LA+KLAS+GFTITFVNTQSVH +IS+A+ DIF+GAR+ Sbjct: 10 HAILIPYPLQGHVIPFVHLAIKLASNGFTITFVNTQSVHHQISQAQPHNSPEDIFAGARN 69 Query: 265 S 267 S Sbjct: 70 S 70 >ref|XP_002276858.1| PREDICTED: UDP-glycosyltransferase 86A1 [Vitis vinifera] Length = 481 Score = 87.8 bits (216), Expect = 8e-16 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = +1 Query: 85 HAVMIPYPYQGHINPFVSLAVKLASHGFTITFVNTQSVHRRISRARTAPKCADIFSGARD 264 HA++IPYP QGH+ PFV LA+KLAS+GFTITFVNTQSVH +IS+A+ DIF+GAR+ Sbjct: 10 HAILIPYPLQGHVIPFVHLAIKLASNGFTITFVNTQSVHHQISQAQPHNSPEDIFAGARN 69 Query: 265 S 267 S Sbjct: 70 S 70 >ref|XP_002879636.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis lyrata subsp. lyrata] gi|297325475|gb|EFH55895.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis lyrata subsp. lyrata] Length = 487 Score = 84.3 bits (207), Expect = 9e-15 Identities = 42/64 (65%), Positives = 46/64 (71%) Frame = +1 Query: 76 RKGHAVMIPYPYQGHINPFVSLAVKLASHGFTITFVNTQSVHRRISRARTAPKCADIFSG 255 RK H +MIPYP QGH+ PFV LA+KLASHGFTITFVNT S+H IS A DIFS Sbjct: 7 RKPHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTAHHG-DAGDIFSS 65 Query: 256 ARDS 267 AR S Sbjct: 66 ARSS 69 >ref|NP_181234.1| UDP-glycosyltransferase-like protein [Arabidopsis thaliana] gi|75313513|sp|Q9SJL0.1|U86A1_ARATH RecName: Full=UDP-glycosyltransferase 86A1 gi|4883613|gb|AAD31582.1| putative glucosyltransferase [Arabidopsis thaliana] gi|15809994|gb|AAL06924.1| At2g36970/T1J8.15 [Arabidopsis thaliana] gi|22137016|gb|AAM91353.1| At2g36970/T1J8.15 [Arabidopsis thaliana] gi|330254235|gb|AEC09329.1| UDP-glycosyltransferase-like protein [Arabidopsis thaliana] Length = 490 Score = 84.3 bits (207), Expect = 9e-15 Identities = 42/64 (65%), Positives = 46/64 (71%) Frame = +1 Query: 76 RKGHAVMIPYPYQGHINPFVSLAVKLASHGFTITFVNTQSVHRRISRARTAPKCADIFSG 255 RK H +MIPYP QGH+ PFV LA+KLASHGFTITFVNT S+H IS A DIFS Sbjct: 7 RKPHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTAH-QDDAGDIFSA 65 Query: 256 ARDS 267 AR S Sbjct: 66 ARSS 69 >gb|AFJ53011.1| UDP-glycosyltransferase 1 [Linum usitatissimum] Length = 489 Score = 79.0 bits (193), Expect = 4e-13 Identities = 40/75 (53%), Positives = 53/75 (70%), Gaps = 2/75 (2%) Frame = +1 Query: 49 KEKRMAGGER--KGHAVMIPYPYQGHINPFVSLAVKLASHGFTITFVNTQSVHRRISRAR 222 +E ++ GG R K HA+++PYP QGHI P V LA+KLAS GFTIT++NT+ +H + S A Sbjct: 3 EETQIDGGHRGSKPHAILVPYPLQGHIIPAVHLAIKLASQGFTITYINTEYIHHKTSSA- 61 Query: 223 TAPKCADIFSGARDS 267 A D+FSG RDS Sbjct: 62 AAGGGDDVFSGVRDS 76