BLASTX nr result
ID: Scutellaria22_contig00035480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035480 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 ref|XP_003616977.1| hypothetical protein MTR_5g086360 [Medicago ... 40 8e-06 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 67.4 bits (163), Expect = 1e-09 Identities = 38/71 (53%), Positives = 43/71 (60%), Gaps = 5/71 (7%) Frame = -1 Query: 211 LPLQRAGSLRCSVKPAWRGALHSMSHRAHAKAQ-----LPAWNGQAQILPHMAQPVVPEQ 47 LPL RAG RCSVKPA R AL S + A AQ L AWNG+A+ PH +P PEQ Sbjct: 22 LPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRARAQPHQGRPTGPEQ 81 Query: 46 RPITLKASTRI 14 RPITL R+ Sbjct: 82 RPITLMPLLRL 92 >ref|XP_003616977.1| hypothetical protein MTR_5g086360 [Medicago truncatula] gi|355518312|gb|AES99935.1| hypothetical protein MTR_5g086360 [Medicago truncatula] Length = 81 Score = 39.7 bits (91), Expect(2) = 8e-06 Identities = 21/39 (53%), Positives = 23/39 (58%) Frame = -1 Query: 208 PLQRAGSLRCSVKPAWRGALHSMSHRAHAKAQLPAWNGQ 92 PL RA LRCS KPA R AL S + A AQ+P N Q Sbjct: 19 PLSRARGLRCSAKPASRSALSSRNQETKAFAQIPWPNSQ 57 Score = 34.7 bits (78), Expect(2) = 8e-06 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 117 PNSQLGTGRPRYCHTWPSQLSQNNV 43 PNSQLG G+P YC PS S ++V Sbjct: 54 PNSQLGEGKPTYCRNQPSPTSHSHV 78