BLASTX nr result
ID: Scutellaria22_contig00035384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035384 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520416.1| leucine-rich repeat containing protein, puta... 84 2e-14 ref|XP_002520413.1| hypothetical protein RCOM_1397400 [Ricinus c... 82 5e-14 ref|XP_002515943.1| leucine-rich repeat containing protein, puta... 81 8e-14 ref|XP_004136758.1| PREDICTED: putative disease resistance prote... 77 2e-12 ref|XP_003632840.1| PREDICTED: putative disease resistance prote... 75 4e-12 >ref|XP_002520416.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223540401|gb|EEF41971.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 661 Score = 83.6 bits (205), Expect = 2e-14 Identities = 41/80 (51%), Positives = 55/80 (68%) Frame = -2 Query: 243 KLYNLQFLWLTSCVLEHIPCEIGNLVQLRHLDLRGNIFLRELPESLCSLHELQTLNVDNC 64 +L L+ L L++C L IP I L+ LR +DL N L+ LPE+LC L LQTLN+D C Sbjct: 354 RLTCLRSLNLSNCNLAEIPSSISKLIHLRQIDLSYNKDLKGLPEALCELDNLQTLNMDGC 413 Query: 63 FALSGLPKGIHRLINLKHLH 4 F+L LP+G+ +LINL+HLH Sbjct: 414 FSLVKLPRGVEKLINLRHLH 433 >ref|XP_002520413.1| hypothetical protein RCOM_1397400 [Ricinus communis] gi|223540398|gb|EEF41968.1| hypothetical protein RCOM_1397400 [Ricinus communis] Length = 387 Score = 82.0 bits (201), Expect = 5e-14 Identities = 41/80 (51%), Positives = 55/80 (68%) Frame = -2 Query: 243 KLYNLQFLWLTSCVLEHIPCEIGNLVQLRHLDLRGNIFLRELPESLCSLHELQTLNVDNC 64 +L L+ L L++C L IP I L+ LR +DL N L+ LPE+LC L LQTLN+D C Sbjct: 41 RLTCLRSLNLSNCNLAEIPSSIRKLIHLRQIDLSYNKDLKGLPEALCELCNLQTLNMDGC 100 Query: 63 FALSGLPKGIHRLINLKHLH 4 F+L LP+G+ +LINL+HLH Sbjct: 101 FSLVKLPRGVEKLINLRHLH 120 >ref|XP_002515943.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223544848|gb|EEF46363.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 786 Score = 81.3 bits (199), Expect = 8e-14 Identities = 41/80 (51%), Positives = 55/80 (68%) Frame = -2 Query: 243 KLYNLQFLWLTSCVLEHIPCEIGNLVQLRHLDLRGNIFLRELPESLCSLHELQTLNVDNC 64 +L L+ L L++C L IP I L+ LR +DL N L+ LPE+LC L LQTLN+D C Sbjct: 383 RLTCLRSLNLSNCNLAEIPSSICKLIHLRQIDLSYNKDLKGLPEALCELCNLQTLNMDGC 442 Query: 63 FALSGLPKGIHRLINLKHLH 4 F+L LP+G+ +LINL+HLH Sbjct: 443 FSLVKLPRGLEKLINLRHLH 462 >ref|XP_004136758.1| PREDICTED: putative disease resistance protein RGA1-like [Cucumis sativus] Length = 892 Score = 76.6 bits (187), Expect = 2e-12 Identities = 40/88 (45%), Positives = 56/88 (63%) Frame = -2 Query: 270 SSQDSKTICKLYNLQFLWLTSCVLEHIPCEIGNLVQLRHLDLRGNIFLRELPESLCSLHE 91 +S K I K L+ L+L++ L+ IP IG L LR+LDL GN ++ LP S+C+L Sbjct: 628 ASLTEKCIWKYKGLRLLYLSNADLQEIPNSIGTLKYLRYLDLHGNTKIKHLPNSICNLQS 687 Query: 90 LQTLNVDNCFALSGLPKGIHRLINLKHL 7 LQTL + +C AL LPK I LI+L++L Sbjct: 688 LQTLILGSCSALEDLPKDIRNLISLRYL 715 >ref|XP_003632840.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Length = 903 Score = 75.5 bits (184), Expect = 4e-12 Identities = 33/66 (50%), Positives = 49/66 (74%) Frame = -2 Query: 204 VLEHIPCEIGNLVQLRHLDLRGNIFLRELPESLCSLHELQTLNVDNCFALSGLPKGIHRL 25 ++E +P E+G L+ LR L+L G +LRELPE++C L+ LQTLN+ C +L LP+ + +L Sbjct: 570 LIEELPKEVGKLIHLRFLNLSGCFWLRELPETICDLYNLQTLNIQGCSSLRKLPQAMGKL 629 Query: 24 INLKHL 7 INL+HL Sbjct: 630 INLRHL 635