BLASTX nr result
ID: Scutellaria22_contig00035358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035358 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65788.1| hypothetical protein VITISV_037591 [Vitis vinifera] 42 2e-07 >emb|CAN65788.1| hypothetical protein VITISV_037591 [Vitis vinifera] Length = 268 Score = 42.4 bits (98), Expect(2) = 2e-07 Identities = 23/48 (47%), Positives = 27/48 (56%), Gaps = 14/48 (29%) Frame = -2 Query: 234 PSFNSYSSNRLAEIAVKVAAEKSE--------------DNDGDEDFEF 133 PSFNSY+S RLAEIA ++ E E DNDGD+D EF Sbjct: 11 PSFNSYNSGRLAEIAARIIEELGESDGNDDEEVKEDEVDNDGDDDSEF 58 Score = 37.4 bits (85), Expect(2) = 2e-07 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = -3 Query: 104 SAEDFAYEGQIGPIFPVFNRDIWRINGGDNDPS 6 SA++ Y GQI P+FP+FNRD+ G + + S Sbjct: 71 SADEIFYNGQIRPVFPIFNRDLLLXEGQNQEVS 103