BLASTX nr result
ID: Scutellaria22_contig00035334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035334 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634354.1| PREDICTED: calcium-dependent protein kinase ... 71 1e-10 ref|XP_002284750.2| PREDICTED: calcium-dependent protein kinase ... 71 1e-10 emb|CAN67210.1| hypothetical protein VITISV_026712 [Vitis vinifera] 71 1e-10 ref|XP_002510594.1| calcium-dependent protein kinase, putative [... 70 1e-10 ref|NP_974150.2| calcium-dependent protein kinase 29 [Arabidopsi... 70 2e-10 >ref|XP_003634354.1| PREDICTED: calcium-dependent protein kinase 29-like isoform 2 [Vitis vinifera] Length = 529 Score = 70.9 bits (172), Expect = 1e-10 Identities = 36/50 (72%), Positives = 38/50 (76%) Frame = -1 Query: 247 GFITRDELRQAMTQYGMGDEATIXXXXXXXXXXXDGRINYEEFVAMMKNG 98 GFITR+EL+QAMTQYGMGDEATI DGRINYEEFVAMMK G Sbjct: 471 GFITREELKQAMTQYGMGDEATIDEVIDDVDTDKDGRINYEEFVAMMKKG 520 >ref|XP_002284750.2| PREDICTED: calcium-dependent protein kinase 29-like isoform 1 [Vitis vinifera] gi|302141719|emb|CBI18922.3| unnamed protein product [Vitis vinifera] Length = 523 Score = 70.9 bits (172), Expect = 1e-10 Identities = 36/50 (72%), Positives = 38/50 (76%) Frame = -1 Query: 247 GFITRDELRQAMTQYGMGDEATIXXXXXXXXXXXDGRINYEEFVAMMKNG 98 GFITR+EL+QAMTQYGMGDEATI DGRINYEEFVAMMK G Sbjct: 465 GFITREELKQAMTQYGMGDEATIDEVIDDVDTDKDGRINYEEFVAMMKKG 514 >emb|CAN67210.1| hypothetical protein VITISV_026712 [Vitis vinifera] Length = 548 Score = 70.9 bits (172), Expect = 1e-10 Identities = 36/50 (72%), Positives = 38/50 (76%) Frame = -1 Query: 247 GFITRDELRQAMTQYGMGDEATIXXXXXXXXXXXDGRINYEEFVAMMKNG 98 GFITR+EL+QAMTQYGMGDEATI DGRINYEEFVAMMK G Sbjct: 465 GFITREELKQAMTQYGMGDEATIDEVIDDVDTDKDGRINYEEFVAMMKKG 514 >ref|XP_002510594.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223551295|gb|EEF52781.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 529 Score = 70.5 bits (171), Expect = 1e-10 Identities = 35/51 (68%), Positives = 39/51 (76%) Frame = -1 Query: 247 GFITRDELRQAMTQYGMGDEATIXXXXXXXXXXXDGRINYEEFVAMMKNGT 95 G+ITRDELRQAM+QYGMGD+ATI DGRINYEEFVAMM+ GT Sbjct: 472 GYITRDELRQAMSQYGMGDDATIDEILEDVDSNKDGRINYEEFVAMMRKGT 522 >ref|NP_974150.2| calcium-dependent protein kinase 29 [Arabidopsis thaliana] gi|332197666|gb|AEE35787.1| calcium-dependent protein kinase 29 [Arabidopsis thaliana] Length = 561 Score = 70.1 bits (170), Expect = 2e-10 Identities = 36/60 (60%), Positives = 42/60 (70%) Frame = -1 Query: 247 GFITRDELRQAMTQYGMGDEATIXXXXXXXXXXXDGRINYEEFVAMMKNGTTVDFAEQIR 68 GFITRDEL+ +MT+YGMGD+ATI DGRINYEEFVAMM+ GTT + IR Sbjct: 502 GFITRDELKHSMTEYGMGDDATIDEVINDVDTDNDGRINYEEFVAMMRKGTTDSDPKLIR 561