BLASTX nr result
ID: Scutellaria22_contig00035263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035263 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299498.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002509901.1| atpob1, putative [Ricinus communis] gi|22354... 60 1e-07 ref|XP_002511953.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 ref|XP_002303621.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 ref|XP_004149767.1| PREDICTED: uncharacterized protein LOC101207... 58 7e-07 >ref|XP_002299498.1| predicted protein [Populus trichocarpa] gi|222846756|gb|EEE84303.1| predicted protein [Populus trichocarpa] Length = 295 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/75 (45%), Positives = 52/75 (69%), Gaps = 2/75 (2%) Frame = +1 Query: 115 IVVVVLDAWLWQFVRGSESYNRDSLDSFLYDYAFKRIPRH--YAGKVFDVIPPSNMSGVE 288 I+ ++L + V S++YN D+LD+FL D AFK + RH + G ++ + P+N+SGV+ Sbjct: 5 IIWLLLSLYFSPSVHSSDNYNTDTLDAFLQDSAFKSLVRHRPHTGALYKALLPANLSGVQ 64 Query: 289 VSIVRLRSRSLWKNG 333 VSIVR+RSR+LW G Sbjct: 65 VSIVRIRSRTLWNIG 79 >ref|XP_002509901.1| atpob1, putative [Ricinus communis] gi|223549800|gb|EEF51288.1| atpob1, putative [Ricinus communis] Length = 734 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 2/65 (3%) Frame = +1 Query: 145 WQFVRGSESYNRDSLDSFLYDYAFKRIPRH--YAGKVFDVIPPSNMSGVEVSIVRLRSRS 318 +++ +Y +SLD+FL D AFK + RH G ++ + P+N+SG+EVSIVRLRSR Sbjct: 455 FEYYLSVHNYTTNSLDAFLQDSAFKTLVRHRPQTGALYTALLPANLSGMEVSIVRLRSRR 514 Query: 319 LWKNG 333 LW G Sbjct: 515 LWNIG 519 >ref|XP_002511953.1| conserved hypothetical protein [Ricinus communis] gi|223549133|gb|EEF50622.1| conserved hypothetical protein [Ricinus communis] Length = 275 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/60 (45%), Positives = 41/60 (68%) Frame = +1 Query: 154 VRGSESYNRDSLDSFLYDYAFKRIPRHYAGKVFDVIPPSNMSGVEVSIVRLRSRSLWKNG 333 V GS S + +SLD+ +Y+YA + + R + GK+ +V PSN SG++ S+ R RS SLW+ G Sbjct: 4 VHGSSSNDPESLDASIYNYAVEALLRQHTGKLLNVSLPSNFSGIKASVFRTRSGSLWQRG 63 >ref|XP_002303621.1| predicted protein [Populus trichocarpa] gi|222841053|gb|EEE78600.1| predicted protein [Populus trichocarpa] Length = 284 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/59 (49%), Positives = 43/59 (72%), Gaps = 2/59 (3%) Frame = +1 Query: 163 SESYNRDSLDSFLYDYAFKRIPRHY--AGKVFDVIPPSNMSGVEVSIVRLRSRSLWKNG 333 S+++ D+LD+FL D AFK + R + G ++ + P N+SG+EVSIVR+RSR+LWK G Sbjct: 8 SDNFTTDTLDTFLQDSAFKSLVRQWPHTGALYKGLIPVNLSGMEVSIVRIRSRTLWKIG 66 >ref|XP_004149767.1| PREDICTED: uncharacterized protein LOC101207860 [Cucumis sativus] gi|449522895|ref|XP_004168461.1| PREDICTED: uncharacterized protein LOC101229777 [Cucumis sativus] Length = 290 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 2/75 (2%) Frame = +1 Query: 115 IVVVVLDAWLWQFVRGSESYNRDSLDSFLYDYAFKRIPRH--YAGKVFDVIPPSNMSGVE 288 ++V+V FV + + S+D+FL + AFK + R Y G ++ P+N+SG+E Sbjct: 6 MIVLVFSVTFCPFVHSLQGNDSISMDAFLQETAFKTLVRRRPYTGALYRASLPANLSGME 65 Query: 289 VSIVRLRSRSLWKNG 333 VS+VRLRSR LW G Sbjct: 66 VSVVRLRSRRLWDKG 80