BLASTX nr result
ID: Scutellaria22_contig00035240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035240 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002452948.1| hypothetical protein SORBIDRAFT_04g035400 [S... 59 5e-07 ref|XP_002515378.1| glutamate receptor 2 plant, putative [Ricinu... 59 5e-07 ref|XP_002515377.1| glutamate receptor 2 plant, putative [Ricinu... 59 5e-07 ref|XP_002515372.1| glutamate receptor 2 plant, putative [Ricinu... 58 7e-07 ref|XP_002336789.1| glutamate-gated kainate-type ion channel rec... 57 1e-06 >ref|XP_002452948.1| hypothetical protein SORBIDRAFT_04g035400 [Sorghum bicolor] gi|241932779|gb|EES05924.1| hypothetical protein SORBIDRAFT_04g035400 [Sorghum bicolor] Length = 1004 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/75 (37%), Positives = 42/75 (56%) Frame = +1 Query: 1 IKTYRSVEDCRKDLSSGSISAYCDVLPHIKLILSQSCGKYKMVDPIYRTDXXXXXXXXXX 180 +K+Y + E LSSG ++A D +P++KL LSQ C Y MV P+Y+TD Sbjct: 731 MKSYSTAEKYADALSSGQVAAVFDEIPYLKLFLSQYCDGYTMVGPVYKTDGFGFVFPMGS 790 Query: 181 XXVSDISRAIIKVIE 225 D+SRA++ + E Sbjct: 791 PLTPDVSRAVLTLAE 805 >ref|XP_002515378.1| glutamate receptor 2 plant, putative [Ricinus communis] gi|223545322|gb|EEF46827.1| glutamate receptor 2 plant, putative [Ricinus communis] Length = 931 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/78 (39%), Positives = 43/78 (55%), Gaps = 4/78 (5%) Frame = +1 Query: 4 KTYRSVEDCR----KDLSSGSISAYCDVLPHIKLILSQSCGKYKMVDPIYRTDXXXXXXX 171 K Y S E+C K +G I+A D +P+IKL L+Q C KY MV+P ++T Sbjct: 696 KVYNSTEECNELFVKGTRNGGIAAAFDEVPYIKLFLAQYCSKYTMVEPTFKTGGFGFVFP 755 Query: 172 XXXXXVSDISRAIIKVIE 225 V D+SRAI+ VI+ Sbjct: 756 KRSPLVPDVSRAILDVIQ 773 >ref|XP_002515377.1| glutamate receptor 2 plant, putative [Ricinus communis] gi|223545321|gb|EEF46826.1| glutamate receptor 2 plant, putative [Ricinus communis] Length = 961 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 4/79 (5%) Frame = +1 Query: 1 IKTYRSVEDCR----KDLSSGSISAYCDVLPHIKLILSQSCGKYKMVDPIYRTDXXXXXX 168 +K Y+S E+C K +G I+A + +P+IKL L+Q C KY MV+P ++T Sbjct: 719 LKVYKSTEECNELFVKGTRNGGITAAFEEVPYIKLFLAQYCSKYTMVEPTFKTGGFGFVF 778 Query: 169 XXXXXXVSDISRAIIKVIE 225 V D+SRAI+ VI+ Sbjct: 779 PKRSLLVPDVSRAILDVIQ 797 >ref|XP_002515372.1| glutamate receptor 2 plant, putative [Ricinus communis] gi|223545316|gb|EEF46821.1| glutamate receptor 2 plant, putative [Ricinus communis] Length = 971 Score = 58.2 bits (139), Expect = 7e-07 Identities = 34/76 (44%), Positives = 43/76 (56%), Gaps = 4/76 (5%) Frame = +1 Query: 10 YRSVEDCRKDLSSGS----ISAYCDVLPHIKLILSQSCGKYKMVDPIYRTDXXXXXXXXX 177 Y SVE C + LS GS I+A D LP++K+ L++ C KY MV PI +TD Sbjct: 726 YDSVEQCHELLSKGSRNGGIAAAFDELPYMKVFLAKYCSKYTMVQPITKTDGFGFVFPRG 785 Query: 178 XXXVSDISRAIIKVIE 225 V DISRAI+ V E Sbjct: 786 SPLVPDISRAILNVTE 801 >ref|XP_002336789.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222836912|gb|EEE75305.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Length = 452 Score = 57.4 bits (137), Expect = 1e-06 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 4/79 (5%) Frame = +1 Query: 1 IKTYRSVEDCRKDLSSGS----ISAYCDVLPHIKLILSQSCGKYKMVDPIYRTDXXXXXX 168 +K Y S E+C + S GS I+A D L +IKLILS+ C KY M+DP ++T Sbjct: 203 LKVYGSPEECHRLFSKGSGNGGIAAAFDELAYIKLILSRYCSKYTMIDPKFKTGGLGFVF 262 Query: 169 XXXXXXVSDISRAIIKVIE 225 + DISRAI+ V E Sbjct: 263 PKGSPLMPDISRAILNVTE 281