BLASTX nr result
ID: Scutellaria22_contig00035119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035119 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632809.1| PREDICTED: pentatricopeptide repeat-containi... 117 1e-24 emb|CBI36298.3| unnamed protein product [Vitis vinifera] 117 1e-24 ref|XP_002326537.1| predicted protein [Populus trichocarpa] gi|2... 100 2e-19 dbj|BAJ53231.1| JHL06P13.11 [Jatropha curcas] 99 5e-19 ref|XP_003546931.1| PREDICTED: pentatricopeptide repeat-containi... 95 5e-18 >ref|XP_003632809.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Vitis vinifera] Length = 879 Score = 117 bits (293), Expect = 1e-24 Identities = 64/107 (59%), Positives = 84/107 (78%), Gaps = 2/107 (1%) Frame = +1 Query: 1 LKFFGFVSRS--SSSLDGFAYSSLLKLLARSKVFSEIDNLLLECLQCEEKRPSREALGYV 174 LKFF +VSR S ++GFAYSSLLKLLARS+VFSE++ ++LE ++ EE P+REA+ V Sbjct: 77 LKFFDWVSRGQYSGPINGFAYSSLLKLLARSRVFSEME-VVLENMRVEEMSPTREAMSIV 135 Query: 175 IRAYAESGSVSKALELYSYVLKNYKELPQLIACNSLLHGLVKDGKVE 315 I+AY++SG V KALELY +VLK Y P +IACNSLL+ LVK G++E Sbjct: 136 IQAYSDSGLVEKALELYYFVLKTYTYFPDVIACNSLLNMLVKLGRIE 182 >emb|CBI36298.3| unnamed protein product [Vitis vinifera] Length = 641 Score = 117 bits (293), Expect = 1e-24 Identities = 64/107 (59%), Positives = 84/107 (78%), Gaps = 2/107 (1%) Frame = +1 Query: 1 LKFFGFVSRS--SSSLDGFAYSSLLKLLARSKVFSEIDNLLLECLQCEEKRPSREALGYV 174 LKFF +VSR S ++GFAYSSLLKLLARS+VFSE++ ++LE ++ EE P+REA+ V Sbjct: 77 LKFFDWVSRGQYSGPINGFAYSSLLKLLARSRVFSEME-VVLENMRVEEMSPTREAMSIV 135 Query: 175 IRAYAESGSVSKALELYSYVLKNYKELPQLIACNSLLHGLVKDGKVE 315 I+AY++SG V KALELY +VLK Y P +IACNSLL+ LVK G++E Sbjct: 136 IQAYSDSGLVEKALELYYFVLKTYTYFPDVIACNSLLNMLVKLGRIE 182 >ref|XP_002326537.1| predicted protein [Populus trichocarpa] gi|222833859|gb|EEE72336.1| predicted protein [Populus trichocarpa] Length = 826 Score = 99.8 bits (247), Expect = 2e-19 Identities = 54/108 (50%), Positives = 76/108 (70%), Gaps = 3/108 (2%) Frame = +1 Query: 1 LKFFGFVSRSSSS---LDGFAYSSLLKLLARSKVFSEIDNLLLECLQCEEKRPSREALGY 171 LK F + S+ S LDGF+ SSLLKLLAR +VF E++NLL E ++C++ P+REAL + Sbjct: 81 LKLFEWASKRSDFNDLLDGFSCSSLLKLLARCRVFVEVENLL-ETMKCKDLAPTREALSF 139 Query: 172 VIRAYAESGSVSKALELYSYVLKNYKELPQLIACNSLLHGLVKDGKVE 315 V+ AY +SG V++ALELY + LP +IACN+LL+ L++ KVE Sbjct: 140 VVGAYVDSGLVNRALELYHIAYDIHNYLPDVIACNALLNALIQQKKVE 187 >dbj|BAJ53231.1| JHL06P13.11 [Jatropha curcas] Length = 826 Score = 98.6 bits (244), Expect = 5e-19 Identities = 59/108 (54%), Positives = 76/108 (70%), Gaps = 3/108 (2%) Frame = +1 Query: 1 LKFFGFVSRSSS---SLDGFAYSSLLKLLARSKVFSEIDNLLLECLQCEEKRPSREALGY 171 L FF + S+ S+ SLDGF SSLLKLLAR +VF EI+NLL E ++ +E P+ EAL + Sbjct: 78 LNFFEWASKQSTLSNSLDGFVCSSLLKLLARFRVFKEIENLL-ETMKSKELIPTCEALSF 136 Query: 172 VIRAYAESGSVSKALELYSYVLKNYKELPQLIACNSLLHGLVKDGKVE 315 VI AYA SG V +ALELY+ V+ + +P + ACNSLL+ LV GKVE Sbjct: 137 VISAYAGSGLVKEALELYNTVIDVHNCVPDVFACNSLLNLLVHHGKVE 184 >ref|XP_003546931.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Glycine max] Length = 808 Score = 95.1 bits (235), Expect = 5e-18 Identities = 55/107 (51%), Positives = 76/107 (71%), Gaps = 2/107 (1%) Frame = +1 Query: 1 LKFFGFVSRS--SSSLDGFAYSSLLKLLARSKVFSEIDNLLLECLQCEEKRPSREALGYV 174 LKFF + S S SLDG A+SSLLKLLA +VF EI+ L+LE ++ + +P+REA + Sbjct: 74 LKFFDWASTRPFSCSLDGVAHSSLLKLLASFRVFPEIE-LVLENMKAQHLKPTREAFSAL 132 Query: 175 IRAYAESGSVSKALELYSYVLKNYKELPQLIACNSLLHGLVKDGKVE 315 I AY ESGS+ +AL+L+ V + + LP ++A NSLL+GLVK GKV+ Sbjct: 133 ILAYGESGSLDRALQLFHTVREMHNCLPTVVASNSLLNGLVKSGKVD 179