BLASTX nr result
ID: Scutellaria22_contig00035088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035088 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277733.1| PREDICTED: pentatricopeptide repeat-containi... 58 7e-07 emb|CAN71816.1| hypothetical protein VITISV_023421 [Vitis vinifera] 58 7e-07 >ref|XP_002277733.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, mitochondrial [Vitis vinifera] gi|296089781|emb|CBI39600.3| unnamed protein product [Vitis vinifera] Length = 498 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -3 Query: 377 KKNKWFPTDETIKLFINYFEENDDTDRAKKFVQSMKKQERVDS 249 + NKWFPT+ETI +F+ YFEE D D A+KF ++M+K R+DS Sbjct: 411 ENNKWFPTEETITMFLEYFEEVKDVDSAEKFCETMRKISRLDS 453 >emb|CAN71816.1| hypothetical protein VITISV_023421 [Vitis vinifera] Length = 494 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -3 Query: 377 KKNKWFPTDETIKLFINYFEENDDTDRAKKFVQSMKKQERVDS 249 + NKWFPT+ETI +F+ YFEE D D A+KF ++M+K R+DS Sbjct: 407 ENNKWFPTEETITMFLEYFEEVKDVDSAEKFCETMRKISRLDS 449