BLASTX nr result
ID: Scutellaria22_contig00034308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00034308 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529080.1| PREDICTED: uncharacterized protein LOC100784... 61 1e-07 emb|CAA66483.1| transcripteion factor [Vicia faba var. minor] 55 4e-06 ref|XP_003625016.1| hypothetical protein MTR_7g090060 [Medicago ... 55 6e-06 >ref|XP_003529080.1| PREDICTED: uncharacterized protein LOC100784450 [Glycine max] Length = 426 Score = 60.8 bits (146), Expect = 1e-07 Identities = 31/61 (50%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = -2 Query: 398 SDFQDQKLSHSDEKFTSN--CGFIMDDGSPCTTKPVQGNKRCLEHKGRRIRKSNLHLQGK 225 +D +D + DE T+ CG I++DGS CT PV+G KRC EHKGRRIR S H+ K Sbjct: 367 NDVEDPPQTLVDESITNTNICGIILNDGSTCTRHPVKGRKRCHEHKGRRIRAS-FHIANK 425 Query: 224 K 222 K Sbjct: 426 K 426 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 3/55 (5%) Frame = -2 Query: 395 DFQDQKLSHSDEKFTSN---CGFIMDDGSPCTTKPVQGNKRCLEHKGRRIRKSNL 240 D +D + DE T+ CG ++ DGS CT +PV+G KRC EHKGRRIR +++ Sbjct: 298 DLEDPPQTVVDESLTNTDYICGILLSDGSTCTRQPVKGRKRCHEHKGRRIRAASI 352 >emb|CAA66483.1| transcripteion factor [Vicia faba var. minor] Length = 377 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 4/57 (7%) Frame = -2 Query: 404 RCSDFQDQKLSHS--DEKFTSN--CGFIMDDGSPCTTKPVQGNKRCLEHKGRRIRKS 246 R S + +K+S S DE T CG +++DGS C +PV+G KRC EHKG+R+R S Sbjct: 315 RRSKSESEKVSESLVDESITKTVICGIVLEDGSTCRKEPVKGRKRCHEHKGKRVRAS 371 >ref|XP_003625016.1| hypothetical protein MTR_7g090060 [Medicago truncatula] gi|134054013|gb|ABD28323.2| Excinuclease ABC, C subunit, N-terminal, putative [Medicago truncatula] gi|355500031|gb|AES81234.1| hypothetical protein MTR_7g090060 [Medicago truncatula] Length = 441 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/42 (59%), Positives = 29/42 (69%), Gaps = 2/42 (4%) Frame = -2 Query: 371 HSDEKFTSN--CGFIMDDGSPCTTKPVQGNKRCLEHKGRRIR 252 H +E T CG I+DDGS C +PV+G KRC EHKGRRIR Sbjct: 398 HVEEGITKTIICGIILDDGSTCRRQPVKGRKRCQEHKGRRIR 439