BLASTX nr result
ID: Scutellaria22_contig00032833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00032833 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281961.2| PREDICTED: myocyte-specific enhancer factor ... 57 1e-06 emb|CAN79983.1| hypothetical protein VITISV_038034 [Vitis vinifera] 57 1e-06 >ref|XP_002281961.2| PREDICTED: myocyte-specific enhancer factor 2A homolog [Vitis vinifera] gi|297733964|emb|CBI15211.3| unnamed protein product [Vitis vinifera] Length = 375 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/55 (40%), Positives = 39/55 (70%) Frame = +1 Query: 4 MEPAKDASFQLSGMDYQINGNFELPRSVYNNFPHSLVPTAGSCAISMLNDNSYPQ 168 ++P + + Q + +DYQ+NGNFE+P +Y+N H+ V +G C+I+M ++NS+ Q Sbjct: 301 LKPEMEMNLQGNPVDYQVNGNFEIPAPIYDNRQHTWVSASGPCSIAMFDENSFSQ 355 >emb|CAN79983.1| hypothetical protein VITISV_038034 [Vitis vinifera] Length = 465 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/55 (40%), Positives = 39/55 (70%) Frame = +1 Query: 4 MEPAKDASFQLSGMDYQINGNFELPRSVYNNFPHSLVPTAGSCAISMLNDNSYPQ 168 ++P + + Q + +DYQ+NGNFE+P +Y+N H+ V +G C+I+M ++NS+ Q Sbjct: 375 LKPEMEMNLQGNPVDYQVNGNFEIPAPIYDNRQHTWVSASGPCSIAMFDENSFSQ 429