BLASTX nr result
ID: Scutellaria22_contig00032658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00032658 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001240057.1| uncharacterized protein LOC100787790 [Glycin... 69 5e-10 ref|XP_002522818.1| transcription factor, putative [Ricinus comm... 67 1e-09 gb|AFK40972.1| unknown [Medicago truncatula] 66 3e-09 ref|XP_003607709.1| C2H2 zinc finger protein [Medicago truncatul... 66 3e-09 ref|XP_003607708.1| C2H2 zinc finger protein [Medicago truncatul... 66 3e-09 >ref|NP_001240057.1| uncharacterized protein LOC100787790 [Glycine max] gi|255636705|gb|ACU18688.1| unknown [Glycine max] Length = 441 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 154 DTSPTVWFSLKKSLHCKSEPSDVLNPTTRKQLSSILTRK 270 D PTVWFSLKKSLHCKSEPSDV +P TRKQLS+ILT++ Sbjct: 15 DNMPTVWFSLKKSLHCKSEPSDVHDPKTRKQLSTILTKR 53 >ref|XP_002522818.1| transcription factor, putative [Ricinus communis] gi|223537902|gb|EEF39516.1| transcription factor, putative [Ricinus communis] Length = 385 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 163 PTVWFSLKKSLHCKSEPSDVLNPTTRKQLSSILTRK 270 PTVWFSLKKSLHCKSEPSDV +P +RKQLS+ILTRK Sbjct: 2 PTVWFSLKKSLHCKSEPSDVHDPKSRKQLSTILTRK 37 >gb|AFK40972.1| unknown [Medicago truncatula] Length = 437 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 163 PTVWFSLKKSLHCKSEPSDVLNPTTRKQLSSILTRK 270 PTVWFSLKKSLHCKSEPSDV +P TRK LS+ILT+K Sbjct: 12 PTVWFSLKKSLHCKSEPSDVHDPKTRKHLSTILTKK 47 >ref|XP_003607709.1| C2H2 zinc finger protein [Medicago truncatula] gi|355508764|gb|AES89906.1| C2H2 zinc finger protein [Medicago truncatula] Length = 231 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 163 PTVWFSLKKSLHCKSEPSDVLNPTTRKQLSSILTRK 270 PTVWFSLKKSLHCKSEPSDV +P TRK LS+ILT+K Sbjct: 12 PTVWFSLKKSLHCKSEPSDVHDPKTRKHLSTILTKK 47 >ref|XP_003607708.1| C2H2 zinc finger protein [Medicago truncatula] gi|358345288|ref|XP_003636713.1| C2H2 zinc finger protein [Medicago truncatula] gi|355502648|gb|AES83851.1| C2H2 zinc finger protein [Medicago truncatula] gi|355508763|gb|AES89905.1| C2H2 zinc finger protein [Medicago truncatula] Length = 437 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 163 PTVWFSLKKSLHCKSEPSDVLNPTTRKQLSSILTRK 270 PTVWFSLKKSLHCKSEPSDV +P TRK LS+ILT+K Sbjct: 12 PTVWFSLKKSLHCKSEPSDVHDPKTRKHLSTILTKK 47