BLASTX nr result
ID: Scutellaria22_contig00032543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00032543 (607 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263220.2| PREDICTED: probable chitinase 3-like [Vitis ... 62 6e-08 emb|CBI25622.3| unnamed protein product [Vitis vinifera] 62 6e-08 emb|CAN60686.1| hypothetical protein VITISV_036053 [Vitis vinifera] 62 6e-08 >ref|XP_002263220.2| PREDICTED: probable chitinase 3-like [Vitis vinifera] Length = 717 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 500 GIKGAYWPSGYAQMVPPSSIPTSYFTHIFYAFVPVD 607 GIKGAYWPS A+ +PP IPTSYFTH+FYAFV +D Sbjct: 370 GIKGAYWPSWLAESLPPVGIPTSYFTHLFYAFVQLD 405 >emb|CBI25622.3| unnamed protein product [Vitis vinifera] Length = 357 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 500 GIKGAYWPSGYAQMVPPSSIPTSYFTHIFYAFVPVD 607 GIKGAYWPS A+ +PP IPTSYFTH+FYAFV +D Sbjct: 10 GIKGAYWPSWLAESLPPVGIPTSYFTHLFYAFVQLD 45 >emb|CAN60686.1| hypothetical protein VITISV_036053 [Vitis vinifera] Length = 618 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 500 GIKGAYWPSGYAQMVPPSSIPTSYFTHIFYAFVPVD 607 GIKGAYWPS A+ +PP IPTSYFTH+FYAFV +D Sbjct: 271 GIKGAYWPSWLAESLPPVGIPTSYFTHLFYAFVQLD 306