BLASTX nr result
ID: Scutellaria22_contig00032458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00032458 (583 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007353945.1| cytochrome b6/f complex subunit IV (chloropl... 141 7e-32 ref|YP_007025922.1| cytochrome b6/f complex subunit IV [Vacciniu... 141 7e-32 ref|XP_003605602.1| Cytochrome b6-f complex subunit [Medicago tr... 141 7e-32 ref|YP_005090209.1| petD gene product (chloroplast) [Ricinus com... 141 7e-32 ref|YP_003540962.1| cytochrome b6-f complex subunit IV [Phoenix ... 141 7e-32 >ref|YP_007353945.1| cytochrome b6/f complex subunit IV (chloroplast) [Tectona grandis] gi|438687634|emb|CCP47161.1| cytochrome b6/f complex subunit IV (chloroplast) [Tectona grandis] gi|438688318|emb|CCP47250.1| cytochrome b6/f complex subunit IV (chloroplast) [Tectona grandis] gi|438688442|emb|CCP47339.1| cytochrome b6/f complex subunit IV (chloroplast) [Tectona grandis] Length = 174 Score = 141 bits (356), Expect = 7e-32 Identities = 66/67 (98%), Positives = 66/67 (98%) Frame = -2 Query: 201 MSGSFGG*IYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG 22 MSGSFGG IYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG Sbjct: 1 MSGSFGGWIYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG 60 Query: 21 TIACNVG 1 TIACNVG Sbjct: 61 TIACNVG 67 >ref|YP_007025922.1| cytochrome b6/f complex subunit IV [Vaccinium macrocarpon] gi|374093730|gb|AEY84166.1| cytochrome b6/f complex subunit IV (chloroplast) [Vaccinium macrocarpon] gi|385198158|gb|AFI44076.1| cytochrome b6/f complex subunit IV [Vaccinium macrocarpon] Length = 174 Score = 141 bits (356), Expect = 7e-32 Identities = 66/67 (98%), Positives = 66/67 (98%) Frame = -2 Query: 201 MSGSFGG*IYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG 22 MSGSFGG IYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG Sbjct: 1 MSGSFGGWIYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG 60 Query: 21 TIACNVG 1 TIACNVG Sbjct: 61 TIACNVG 67 >ref|XP_003605602.1| Cytochrome b6-f complex subunit [Medicago truncatula] gi|355506657|gb|AES87799.1| Cytochrome b6-f complex subunit [Medicago truncatula] Length = 174 Score = 141 bits (356), Expect = 7e-32 Identities = 66/67 (98%), Positives = 66/67 (98%) Frame = -2 Query: 201 MSGSFGG*IYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG 22 MSGSFGG IYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG Sbjct: 1 MSGSFGGWIYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG 60 Query: 21 TIACNVG 1 TIACNVG Sbjct: 61 TIACNVG 67 >ref|YP_005090209.1| petD gene product (chloroplast) [Ricinus communis] gi|339516197|gb|AEJ82587.1| cytochrome b6/f complex subunit IV [Ricinus communis] Length = 174 Score = 141 bits (356), Expect = 7e-32 Identities = 66/67 (98%), Positives = 66/67 (98%) Frame = -2 Query: 201 MSGSFGG*IYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG 22 MSGSFGG IYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG Sbjct: 1 MSGSFGGWIYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG 60 Query: 21 TIACNVG 1 TIACNVG Sbjct: 61 TIACNVG 67 >ref|YP_003540962.1| cytochrome b6-f complex subunit IV [Phoenix dactylifera] gi|294620608|gb|ADF28177.1| cytochrome b6-f complex subunit IV (chloroplast) [Phoenix dactylifera] Length = 187 Score = 141 bits (356), Expect = 7e-32 Identities = 66/67 (98%), Positives = 66/67 (98%) Frame = -2 Query: 201 MSGSFGG*IYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG 22 MSGSFGG IYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG Sbjct: 1 MSGSFGGWIYKNSPIPITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILG 60 Query: 21 TIACNVG 1 TIACNVG Sbjct: 61 TIACNVG 67