BLASTX nr result
ID: Scutellaria22_contig00032373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00032373 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280600.1| PREDICTED: microtubule-associated protein TO... 57 2e-06 >ref|XP_002280600.1| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Vitis vinifera] Length = 638 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/58 (44%), Positives = 40/58 (68%) Frame = +3 Query: 102 PQLCLQTACVDTISSITAHVNSPSFSVILKPLMVMLFHEQDSIA*IGASHCLSATMDA 275 P +++ C++ IS++++H+ P FS I+KPL LF EQD A IGAS CL++ +DA Sbjct: 103 PDSAVRSTCINAISAMSSHITKPPFSSIVKPLAETLFTEQDHNAQIGASLCLASAIDA 160