BLASTX nr result
ID: Scutellaria22_contig00032371
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00032371 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535489.1| PREDICTED: uncharacterized protein LOC100779... 55 8e-06 >ref|XP_003535489.1| PREDICTED: uncharacterized protein LOC100779157 [Glycine max] Length = 1044 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 3/65 (4%) Frame = -1 Query: 246 LPRSSKATPTSHKTSRSHFHHKRKISLHPF---KGKSRFYLCVFMVIFIFGLASMVLQSS 76 LPRS+ + +++ +RSH H ++ + L F K KS FY + V+F+F LAS+V+QSS Sbjct: 50 LPRSNNNSNSNNNINRSHLHKRKGLLLWLFPFPKSKSGFYAFIIAVVFLFALASLVMQSS 109 Query: 75 IMAVF 61 I +VF Sbjct: 110 ITSVF 114