BLASTX nr result
ID: Scutellaria22_contig00032035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00032035 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK36033.1| unknown [Medicago truncatula] 55 4e-06 gb|ABA98813.1| phenylalanyl-tRNA synthetase class IIc family pro... 55 8e-06 ref|XP_003552705.1| PREDICTED: phenylalanyl-tRNA synthetase, chl... 55 8e-06 ref|XP_003518641.1| PREDICTED: phenylalanyl-tRNA synthetase, chl... 55 8e-06 gb|ACU23750.1| unknown [Glycine max] 55 8e-06 >gb|AFK36033.1| unknown [Medicago truncatula] Length = 229 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 8/42 (19%) Frame = +2 Query: 236 FSLLTLKNCSGG--------VEMRWVDTYFPFTNPSYELEIY 337 F+ LK C GG VEMRWVDTYFPFTNPS+ELEIY Sbjct: 22 FAAEDLKKCLGGLARHLFGDVEMRWVDTYFPFTNPSFELEIY 63 >gb|ABA98813.1| phenylalanyl-tRNA synthetase class IIc family protein, putative, expressed [Oryza sativa Japonica Group] Length = 448 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +2 Query: 254 KNCSGGVEMRWVDTYFPFTNPSYELEIY 337 K+ G VEMRWVDTYFPFTNPS+ELEIY Sbjct: 255 KHLFGAVEMRWVDTYFPFTNPSFELEIY 282 >ref|XP_003552705.1| PREDICTED: phenylalanyl-tRNA synthetase, chloroplastic/mitochondrial-like [Glycine max] Length = 431 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 8/43 (18%) Frame = +2 Query: 233 IFSLLTLKNCS--------GGVEMRWVDTYFPFTNPSYELEIY 337 +F+ LK C G VEMRWVDTYFPFTNPS+ELEIY Sbjct: 223 LFAATDLKQCLEGLARHLFGAVEMRWVDTYFPFTNPSFELEIY 265 >ref|XP_003518641.1| PREDICTED: phenylalanyl-tRNA synthetase, chloroplastic/mitochondrial-like [Glycine max] Length = 431 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 8/43 (18%) Frame = +2 Query: 233 IFSLLTLKNCS--------GGVEMRWVDTYFPFTNPSYELEIY 337 +F+ LK C G VEMRWVDTYFPFTNPS+ELEIY Sbjct: 223 LFAATDLKQCLEGLARHLFGAVEMRWVDTYFPFTNPSFELEIY 265 >gb|ACU23750.1| unknown [Glycine max] Length = 229 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 8/43 (18%) Frame = +2 Query: 233 IFSLLTLKNCS--------GGVEMRWVDTYFPFTNPSYELEIY 337 +F+ LK C G VEMRWVDTYFPFTNPS+ELEIY Sbjct: 21 LFAATDLKQCLEGLARHLFGAVEMRWVDTYFPFTNPSFELEIY 63