BLASTX nr result
ID: Scutellaria22_contig00032017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00032017 (366 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515222.1| hypothetical protein RCOM_1345340 [Ricinus c... 55 6e-06 >ref|XP_002515222.1| hypothetical protein RCOM_1345340 [Ricinus communis] gi|223545702|gb|EEF47206.1| hypothetical protein RCOM_1345340 [Ricinus communis] Length = 115 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/93 (33%), Positives = 47/93 (50%), Gaps = 7/93 (7%) Frame = +1 Query: 4 ESKNCREDKDDEN----IEIFFALMKSMRNKLHQLKEN--NKRKRTTAAAADSGHGDGWA 165 E C D+DDE +E FFAL++ R ++ K+ + KR + W Sbjct: 9 EGSVCNADEDDEQEDQKVEEFFALIRRFREARNRRKDEVQEEEKRKNKIRRLNEEHPSWV 68 Query: 166 PAFQLEDFTSEIQFKKHVPML-QKPCNINNNEK 261 P+F+ EDFT EIQF+ P++ +PCN +K Sbjct: 69 PSFEWEDFTEEIQFRSRPPVIFPRPCNQKQEKK 101