BLASTX nr result
ID: Scutellaria22_contig00031956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00031956 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK61855.1| hypothetical protein [Citrus unshiu] 63 3e-08 ref|XP_002521346.1| hypothetical protein RCOM_0653450 [Ricinus c... 60 2e-07 ref|XP_004144208.1| PREDICTED: uncharacterized protein LOC101209... 57 2e-06 >dbj|BAK61855.1| hypothetical protein [Citrus unshiu] Length = 454 Score = 62.8 bits (151), Expect = 3e-08 Identities = 38/76 (50%), Positives = 49/76 (64%), Gaps = 5/76 (6%) Frame = +3 Query: 69 RNTPSFSSTLLDEICRSIEVDGTADSDDSGVHRETP-TSGFRARSRT----KEEENSRFS 233 R PSFSS+LLDEI RS + DG A S D +RET T R+R R+ +EE+ S Sbjct: 17 RKNPSFSSSLLDEIYRSTD-DGVAKSPDLKFYRETMNTRQSRSRGRSSKPVEEEQMSSLQ 75 Query: 234 RACLVEKWMEKEIVAK 281 RACL+EKWM+K++ K Sbjct: 76 RACLIEKWMDKKVGEK 91 >ref|XP_002521346.1| hypothetical protein RCOM_0653450 [Ricinus communis] gi|223539424|gb|EEF41014.1| hypothetical protein RCOM_0653450 [Ricinus communis] Length = 426 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/78 (38%), Positives = 48/78 (61%), Gaps = 5/78 (6%) Frame = +3 Query: 69 RNTPSFSSTLLDEICRSIEVDGTADSDDSGVHRET-----PTSGFRARSRTKEEENSRFS 233 R PSFSSTLLD I RSI+ ++ ++RET ++GF+ + KEE + Sbjct: 6 RENPSFSSTLLDAIYRSIDESNGKGEEELILYRETMRKKHSSNGFKDGAAVKEERKTSLK 65 Query: 234 RACLVEKWMEKEIVAKKL 287 +AC++EKWME+++ +K+ Sbjct: 66 KACMIEKWMEEKVSYEKV 83 >ref|XP_004144208.1| PREDICTED: uncharacterized protein LOC101209292 [Cucumis sativus] gi|449527370|ref|XP_004170684.1| PREDICTED: uncharacterized protein LOC101230452 [Cucumis sativus] Length = 396 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 1/73 (1%) Frame = +3 Query: 66 HRNTPSFSSTLLDEICRSIEVDGTADSDDSGVHRETPTSGFRARSRT-KEEENSRFSRAC 242 H+N PSFSSTLLDEI RSI+ + ++ +RE T ++R +++E + RAC Sbjct: 9 HKN-PSFSSTLLDEIYRSIDDGEKKPTGETKFYREISTVKKHIKTRAFEDQEMANLRRAC 67 Query: 243 LVEKWMEKEIVAK 281 ++EKWMEK++ K Sbjct: 68 MIEKWMEKKVGEK 80