BLASTX nr result
ID: Scutellaria22_contig00031913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00031913 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615790.1| Nbs-lrr resistance protein [Medicago truncat... 66 3e-09 ref|XP_003615706.1| NBS-LRR resistance protein [Medicago truncat... 66 3e-09 ref|XP_003615650.1| NBS-LRR resistance protein [Medicago truncat... 64 1e-08 ref|XP_003615728.1| NBS-LRR resistance protein [Medicago truncat... 63 2e-08 ref|XP_003615737.1| NBS-LRR resistance protein [Medicago truncat... 62 4e-08 >ref|XP_003615790.1| Nbs-lrr resistance protein [Medicago truncatula] gi|355517125|gb|AES98748.1| Nbs-lrr resistance protein [Medicago truncatula] Length = 992 Score = 66.2 bits (160), Expect = 3e-09 Identities = 41/85 (48%), Positives = 54/85 (63%), Gaps = 5/85 (5%) Frame = +1 Query: 16 LPPIGGLPRLRSLILSDLDALEYMNG-----GDEIGVFPSLEALELRNLPNLKGLLKKEV 180 LP +G LP L+ L L ++ L+Y++ G E+ VFPSLE L L++LPN++GLLK E Sbjct: 774 LPLLGKLPSLKKLRLYGMNNLKYLDDDESEYGMEVSVFPSLEELNLKSLPNIEGLLKVER 833 Query: 181 GVQIMFPNLQSLNILDCGLLILPPL 255 G MFP L L+I DC L LP L Sbjct: 834 GE--MFPCLSKLDIWDCPELGLPCL 856 >ref|XP_003615706.1| NBS-LRR resistance protein [Medicago truncatula] gi|355517041|gb|AES98664.1| NBS-LRR resistance protein [Medicago truncatula] Length = 1327 Score = 65.9 bits (159), Expect = 3e-09 Identities = 42/85 (49%), Positives = 54/85 (63%), Gaps = 5/85 (5%) Frame = +1 Query: 16 LPPIGGLPRLRSLILSDLDALEYMNG-----GDEIGVFPSLEALELRNLPNLKGLLKKEV 180 LP +G LP L+ L L ++D L+Y++ G E+ VFPSLE L+L LPN++GLLK E Sbjct: 739 LPLLGKLPYLKKLELFEMDNLKYLDDDESEDGMEVRVFPSLEVLQLSCLPNIEGLLKVER 798 Query: 181 GVQIMFPNLQSLNILDCGLLILPPL 255 G MFP L SL+I C L LP L Sbjct: 799 GE--MFPCLSSLDIWKCPKLGLPCL 821 >ref|XP_003615650.1| NBS-LRR resistance protein [Medicago truncatula] gi|355516985|gb|AES98608.1| NBS-LRR resistance protein [Medicago truncatula] Length = 1169 Score = 64.3 bits (155), Expect = 1e-08 Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 5/85 (5%) Frame = +1 Query: 16 LPPIGGLPRLRSLILSDLDALEYMNG-----GDEIGVFPSLEALELRNLPNLKGLLKKEV 180 LP +G LP L+ L LS +D L+Y++ G E+ +FPSLE L L LPN++GLLK E Sbjct: 769 LPLLGKLPSLKKLELSYMDNLKYLDDDESQDGMEVRIFPSLEELVLYKLPNIEGLLKVER 828 Query: 181 GVQIMFPNLQSLNILDCGLLILPPL 255 G MFP L SL+I C + LP L Sbjct: 829 GE--MFPCLSSLDIWKCPKIGLPCL 851 >ref|XP_003615728.1| NBS-LRR resistance protein [Medicago truncatula] gi|355517063|gb|AES98686.1| NBS-LRR resistance protein [Medicago truncatula] Length = 1199 Score = 63.2 bits (152), Expect = 2e-08 Identities = 41/82 (50%), Positives = 50/82 (60%), Gaps = 5/82 (6%) Frame = +1 Query: 25 IGGLPRLRSLILSDLDALEYMNG-----GDEIGVFPSLEALELRNLPNLKGLLKKEVGVQ 189 IG LP L+ L LSD+D L+Y++ G E+ VFPSLE L L LPN++GLLK E G Sbjct: 780 IGKLPSLKKLELSDMDNLKYLDDDESQDGVEVRVFPSLEELHLLCLPNIEGLLKVERGE- 838 Query: 190 IMFPNLQSLNILDCGLLILPPL 255 MFP L L I C L +P L Sbjct: 839 -MFPCLSELRITACPKLGVPCL 859 >ref|XP_003615737.1| NBS-LRR resistance protein [Medicago truncatula] gi|355517072|gb|AES98695.1| NBS-LRR resistance protein [Medicago truncatula] Length = 1125 Score = 62.4 bits (150), Expect = 4e-08 Identities = 40/85 (47%), Positives = 51/85 (60%), Gaps = 5/85 (5%) Frame = +1 Query: 16 LPPIGGLPRLRSLILSDLDALEYMNG-----GDEIGVFPSLEALELRNLPNLKGLLKKEV 180 LP G LP L+ L + ++ L+Y++ G E+ FPSLE LEL LPN++GLLK E Sbjct: 765 LPLFGKLPSLKKLRVYGMNNLKYLDDDESEDGMEVRAFPSLEVLELHGLPNIEGLLKVER 824 Query: 181 GVQIMFPNLQSLNILDCGLLILPPL 255 G MFP L SL+I C L LP L Sbjct: 825 GE--MFPCLSSLDIWKCPKLGLPCL 847